KEGG   Rickettsia bellii OSU 85-389: A1I_01345Help
Entry
A1I_01345         CDS       T00602                                 

Definition
(GenBank) UDP-N-acetylglucosamine acyltransferase
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00540  Lipopolysaccharide biosynthesis
rbo01100  Metabolic pathways
rbo01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    A1I_01345
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    A1I_01345
Enzymes [BR:rbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.129  acyl-[acyl-carrier-protein]---UDP-N-acetylglucosamine O-acyltransferase
     A1I_01345
Lipopolysaccharide biosynthesis proteins [BR:rbo01005]
 Lipid A
  A1I_01345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Acetyltransf_11 Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ABV78661
UniProt: A8GUZ4
Position
262829..263674
Genome map
AA seq 281 aa AA seqDB search
MSNSNIHPTSIIAEGAKLGKNVKVGPYCIIGPEVILHDNVELKSHVVIEGITEIGESTVI
YPFASIGQPPQILKYNNERSNTIIGSNNIIREYVTVQAGSQGGGMITRIGNNNLFMVGVH
IGHDCKIGNNVVFANYVSLAGHIEVEDYVIIGGLSAVHQYARIGKHSMIGGLSPVGADVI
PFGLASGKRAVLEGLNLVGMNRKGFDKAESLNALKIVQEIFLGEGNFADRIKQAQEKYKN
NTIVMQIIDFLEHGSNRSFCSFEKTMSLRGELQSNLTKQPN
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaattctaatatacatccaactagtataattgctgaaggtgcaaaacttggtaag
aacgtaaaagttggtccatattgtattattggtccagaagtaatactgcatgataatgta
gaactaaagtctcacgtagttattgaggggattactgaaatcggcgaaagtacagtaatt
tatccgtttgcgtctatcggtcaacctccgcaaatcttaaaatataataatgagcggtca
aatacgataatcggttctaacaatattattagagaatatgttacagtgcaggcaggaagc
caaggcggcggaatgattacaaggataggaaataataatttatttatggttggcgttcat
atcggtcatgattgcaaaatcggtaataatgtagtgtttgctaattatgtaagcctagct
gggcatatagaagtggaagactatgtcataattggtggcttatcggcagttcatcaatat
gcaagaattggtaaacactcaatgattggcggcttatcaccagttggagctgatgtaatc
ccttttggtcttgcaagcggcaaacgtgcagtgcttgaggggctaaacttagtcggcatg
aataggaaagggtttgataaagcagagtctttaaacgctttaaaaatagttcaagaaatc
tttttaggtgaaggtaatttcgctgatagaattaagcaagctcaagagaaatataaaaac
aatactatagtaatgcaaattattgattttcttgagcatggcagtaatagatcgttttgt
tcttttgaaaaaacaatgtcattacgaggagaactacaaagtaatttgacgaagcaaccc
aattaa

DBGET integrated database retrieval system