KEGG   Rickettsia bellii OSU 85-389: A1I_01360Help
Entry
A1I_01360         CDS       T00602                                 

Gene name
secF
Definition
(GenBank) preprotein translocase subunit SecF
  KO
K03074  
preprotein translocase subunit SecF
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    A1I_01360 (secF)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    A1I_01360 (secF)
Secretion system [BR:rbo02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   A1I_01360 (secF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
265207..266118
Genome map
AA seq 303 aa AA seqDB search
MQIYPLRLLPNKIDFDFMNFKKVSYTFSIILSLISFIWIGMYKFNFGIDFAGGIVIEVRL
DQTPDLPKMRQVLGELGIGEVVLQNFGSERDLSIRFGSSSEDNLMKNIELIKSTLQNNFP
YNFEYRKVDFVGPQVGRQLIEAGTMAMLFSFAAIMIYIWVRFEWYFGLGILIALVHDVIL
ALGFMSITKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENLRKYHKKGITEIINLSINE
TLSRTILTVVTTLLANLALVLFGGEAIRSFSVLVFFGIIAGTYSSIFISAPILTIFANKK
FEK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatttatcctttgaggcttttgcctaataaaatcgattttgattttatgaatttt
aaaaaagtcagttacactttctcaattattttatcactcattagctttatttggattggt
atgtacaaatttaatttcggtattgattttgccggaggtatagttatagaagtaaggctt
gaccaaacgccagatttaccaaaaatgcgtcaagttttaggtgagcttggaattggtgaa
gtagtgctgcaaaactttggtagtgagcgtgacttatcgattagatttggtagtagtagc
gaagataatttaatgaaaaatattgagctaattaaatcgacgcttcaaaataattttcct
tataattttgaatatcgtaaggtggattttgttggtccgcaggttggtaggcagttaatt
gaggcagggactatggcaatgctattttcgtttgcggcaattatgatatatatttgggta
cgttttgaatggtattttgggcttggtatacttattgctttagtgcatgatgttatatta
gcacttggatttatgagtataacaaaacttgattttaacttaagcactattgcagcagtg
ttaactatcataggatattctgttaatgattcggtagtgatatatgataggatcagggaa
aatttacgtaaatatcataagaaaggcatcacggaaattataaatttaagtatcaacgaa
actctatccagaacaattttaacagtagtgactactctacttgctaatttggcactggtt
ctttttggcggtgaggcaatccgtagttttagcgtactggtattttttggaataatagca
gggacttattcgtctatttttatttctgccccgatacttacgatatttgccaataaaaaa
tttgagaagtaa

DBGET integrated database retrieval system