KEGG   Rickettsia bellii OSU 85-389: A1I_01365Help
Entry
A1I_01365         CDS       T00602                                 

Definition
(GenBank) NADH dehydrogenase I chain F
  KO
K00335  
NADH-quinone oxidoreductase subunit F [EC:1.6.5.3]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    A1I_01365
Enzymes [BR:rbo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     A1I_01365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
266321..267574
Genome map
AA seq 417 aa AA seqDB search
MLKKEDRIFTNLHGEQSHDLKSSKKLGDWDNTKALLNKGKEWIIEEVKKSGLRGRGGAGF
STGTKWSFMPKESKKPSYLVVNADESEPGTCKDRDILRYEPHKLIEGCLLASFAIGANSC
YIYIRGEFYNEASNIQRALDEAYKDGLIGKNACGSGFNCDIYLHRGAGAYICGEETALLE
SLEGKKGMPRLKPPFPAGFGLYGCPTTINNVESIAVVPTILRRGASWFASIGKPNNTGTK
IFCISGHVNKPCNVEEAMGIPLKEIIEKHAGGVRGGWDNLKAIIPGGSSVPLLPKSLCET
ADMDFDSLKAAGSSLGTGGIIVMDKSTDIIYAIARLSKFYMHESCGQCTPCREGTGWMWR
VMMRLVKGDAKKSEIDQLLEVTKEIEGHTICALGDAAAWPIQGLIKHFRNEIESRIQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaaaagaagatagaatttttactaatttacatggtgagcagagccatgatttg
aaatctagcaagaagcttggtgattgggataatactaaagcattacttaataaaggcaaa
gagtggattattgaagaagttaagaaatcgggacttagagggcgaggtggtgcaggattt
tctaccggcactaaatggtcgtttatgcctaaagaatcaaaaaagccatcttatctagta
gttaatgctgatgaatctgaacccggcacttgcaaagatcgggatatattaagatatgaa
ccacataagttaatagaagggtgtttgcttgccagttttgccataggagcaaatagctgt
tatatctatattagaggggagttttacaacgaagcttccaatattcagcgtgccttagat
gaagcatataaagatggtttgataggaaaaaatgcttgcggttcaggctttaattgtgat
atttatttgcatcgtggagctggagcttatatttgtggagaagaaacagctctgcttgaa
agcttagaaggtaaaaaaggcatgccaaggctaaagccgccttttccggcgggcttcggg
ttgtatggctgtccaaccactataaataatgttgaatctattgcggtagtgccaactatt
ttaaggcgaggagctagttggtttgcatctatcggtaagccaaataataccggtactaag
attttttgtatatcaggtcatgttaataagccttgtaatgttgaagaggcaatggggatt
cctttaaaagaaatcattgaaaaacatgcagggggtgttcgtggcggttgggataacctc
aaagctataataccgggtggctcttccgttcctttgcttcctaaatccttatgcgaaact
gccgatatggactttgatagcttaaaggcagcaggctctagtttaggtactggcgggatt
attgttatggataaatcgactgatattatttatgcaatagcacgtcttagtaagttctat
atgcatgagtcttgcggtcagtgtacgccgtgccgtgagggtacaggatggatgtggcgt
gttatgatgaggctcgttaaaggtgatgccaaaaaatccgaaatagatcagcttcttgaa
gttacaaaggaaatagaggggcataccatttgtgctttaggtgatgctgccgcttggcca
attcaggggctgataaaacattttagaaacgagattgaaagcaggatacaatag

DBGET integrated database retrieval system