KEGG   Rickettsia bellii OSU 85-389: A1I_01420Help
Entry
A1I_01420         CDS       T00602                                 

Definition
(GenBank) Protease activity modulator HflK
  KO
K04088  membrane protease subunit HflK [EC:3.4.-.-]
Organism
rbo  Rickettsia bellii OSU 85-389
Module
rbo_M00742  Aminoglycoside resistance, protease FtsH
Brite
Enzymes [BR:rbo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     A1I_01420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Band_7 DivIVA DUF4168
Motif
Other DBs
NCBI-ProteinID: ABV78676
Position
275338..276348
Genome map
AA seq 336 aa AA seqDB search
MLSKKYIPIFKKSPWKDFNNDKDDNIFTRPRKNQFNFSTKTIILVALASFVLWLASGIYE
VKEGEEAAVTRFGRFVRKGYAGLNYRLPAPFEKEIVEKVKQSRRIEIGYRTNNFVRSGGD
TKNIAGESIMLTGDENIVALNCDVMWHISNLEDFMFNIQKPEETVKSTVESAVREVIGNT
PITWVLSDQKQEITHKIETLAQKILDSYNAGVMIEKVQLLKAEPPAEVIDAYRDVQTSKA
DKEKEINQAQAYNNKVLPEARGAAARIIEEAEAYREEIISKAEGDSQRFSAIYKQYAANK
QVTRDRLYLEVAEEVLSGSNKTIINNALLPHMAIKP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcttagtaaaaaatatatcccaattttcaaaaaatctccgtggaaagattttaataac
gataaagatgataacatattcacaagaccaagaaaaaatcaatttaatttcagtacaaaa
acaataattttagttgctctagcatcttttgttttgtggctcgcttcaggtatttatgaa
gtaaaagaaggtgaagaagcggctgtaacaagatttggacgttttgttcgtaaaggttac
gctggtcttaattatcgtttacctgctccatttgaaaaagaaatagtcgagaaagttaaa
caatcaagacgaattgagattggatatcgtacaaataactttgtgcgtagtggtggtgat
accaaaaatattgccggtgaaagtattatgctaactggtgatgagaatattgttgcttta
aattgtgacgtaatgtggcatattagtaatcttgaggattttatgtttaacatacaaaag
cctgaagaaacagttaagtcaacagtagaaagtgccgttagagaagtaatagggaatacg
cctattacttgggtcttatctgatcagaagcaggaaattactcataaaatagaaacatta
gcacaaaaaattctagatagttataacgctggagtaatgattgaaaaggtgcaattgtta
aaagctgagccacctgctgaggtaatagatgcttatagagatgtgcaaacttcaaaagca
gataaagaaaaggaaataaatcaagctcaagcctataataataaagtattaccggaagct
agaggggcagcagctagaattatagaagaagcagaagcctatagagaggaaataatatca
aaggctgagggagatagtcaaagatttagtgcaatttataagcaatatgctgcaaataag
caagtaactagagacaggctatatttagaagtagctgaagaagtattaagcggctcgaat
aagactattattaataatgcgttacttccgcatatggctattaagccttaa

DBGET integrated database retrieval system