KEGG   Rickettsia bellii OSU 85-389: A1I_01465Help
Entry
A1I_01465         CDS       T00602                                 

Definition
(GenBank) Amino acid ABC transporter permease protein
  KO
K02029  polar amino acid transport system permease protein
Organism
rbo  Rickettsia bellii OSU 85-389
Module
rbo_M00236  Putative polar amino acid transport system
Brite
Transporters [BR:rbo02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    A1I_01465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABV78685
Position
283605..284261
Genome map
AA seq 218 aa AA seqDB search
MFEYLIKFSPKILFIVEGTLITLKYSVIAVIFGLVIGVLLALCKVNKNRALRLFADFYTS
IFRGTPLLIQLSIIYFASPYLIGIKFTVFMAGAISFSLNSGAYVSEVIRAGINAVDKGQF
EAAEALAIPKFLIMKDIILPQAIKNIFPSLTNELINLIKESAIISMFGEMDLMKRAQIVS
LETYNYFSPMIVAACCYYILVMLISFIARIIEKKLIVS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatatttaataaaattttctccaaaaattctttttattgtagaaggaactttg
atcactttaaaatatagcgttattgctgttatatttggtctagttataggagtattgcta
gcactttgtaaggtaaataaaaatcgtgcattaagacttttcgcagatttttatacttcc
atttttagaggcacacctttattaattcagttaagtattatatattttgcatcgccttat
ttaataggtattaaatttactgtatttatggcaggtgctatttctttttctcttaattca
ggtgcttatgtttcggaagtaataagagcaggaattaatgcagttgataaagggcagttt
gaggcggcagaagctcttgctatccccaaatttttgattatgaaagatataattttgcca
caagcaattaaaaatatttttccatcgctaaccaatgagcttattaatttaatcaaagag
tcagccattatttcaatgtttggagaaatggacttgatgaaaagagcacaaattgtatcg
cttgagacgtataattatttttcccccatgattgttgccgcttgttgttactatatttta
gtgatgctaataagttttatagcaagaataatagagaaaaaactaattgttagttaa

DBGET integrated database retrieval system