KEGG   Rickettsia bellii OSU 85-389: A1I_01475Help
Entry
A1I_01475         CDS       T00602                                 

Definition
(GenBank) 30S ribosomal protein S7
  KO
K02992  
small subunit ribosomal protein S7
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    A1I_01475
Ribosome [BR:rbo03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    A1I_01475
  Bacteria
    A1I_01475
  Archaea
    A1I_01475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
285061..285462
Genome map
AA seq 133 aa AA seqDB search
MKEGKKALAEKIVYSAFDKIEKKHKADPYQTFSNAMNNVKPYLEVTSVRVGGANYQVPTP
VDERRGYALASRWIITAATKRSEKMMIDKLAEELFEASNNRGVAIKKKEDTHKMAEANKA
FSHFSPKKTKQGN
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagggaaaaaaagctctcgcagaaaaaatagtttattctgctttcgataaaatt
gaaaagaaacataaagctgatccgtatcagactttcagtaatgctatgaataatgtaaag
ccatatttggaagtaacttctgtaagagtaggtggagctaattatcaagttccaactccg
gttgatgaaagaagaggctatgctcttgcatctcgttggattattacagcggcaacaaag
cgttctgaaaaaatgatgattgataaactcgctgaagaattatttgaagcttcaaataat
agaggtgttgctattaagaagaaagaagacactcataaaatggctgaagctaataaagct
ttctcacactttagccctaaaaaaacaaagcagggtaactaa

DBGET integrated database retrieval system