KEGG   Rickettsia bellii OSU 85-389: A1I_01490Help
Entry
A1I_01490         CDS       T00602                                 

Gene name
nusG
Definition
(GenBank) transcription antitermination protein NusG
  KO
K02601  transcriptional antiterminator NusG
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
Transcription machinery [BR:rbo03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     A1I_01490 (nusG)
Ribosome biogenesis [BR:rbo03009]
 Prokaryotic Type
  rRNA transcription factors
   A1I_01490 (nusG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NusG KOW
Motif
Other DBs
NCBI-ProteinID: ABV78690
Position
287983..288555
Genome map
AA seq 190 aa AA seqDB search
MAEQNIDDILSNSEKDTKKWYVIHTASGAENRIKRIMLERISKQKMSDFFDDILVPVFGV
SEVKRSKNVKVEKKLMPSYILIKMNMTDKSWHLVKNIPGVTGFLGSKTTPKALTESEIQN
IRLETEAKEAKDAKLYEVGEIVTVTEGPFETFTGTVEEVDQEKARLKVSVSIFGKATPIE
LSFTQVKKND
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaacaaaatatagatgatatattgtcaaattctgaaaaagatacaaaaaagtgg
tatgttatacatactgcatcaggagcagaaaatcgtataaaacgaattatgcttgagaga
attagcaagcagaaaatgtcagatttttttgatgatatattagtaccggtttttggtgtt
tccgaagttaaacgcagtaaaaacgtcaaggtagaaaaaaaattaatgcctagttatatt
ctaataaaaatgaatatgacagataaatcttggcatttagtaaaaaatataccaggagta
acaggctttttaggtagtaaaactactccaaaagctcttacagaaagcgaaatacagaat
attagattagaaacagaagctaaagaagcaaaagatgcgaaattatatgaggtcggcgaa
atagtaactgttacagaaggaccttttgaaacctttacaggtactgtagaagaagtagat
caagaaaaagctagattaaaagtttcagtatcaatatttggtaaagcaactccgatagag
ttgagctttactcaagtaaagaaaaacgactaa

DBGET integrated database retrieval system