KEGG   Rickettsia bellii OSU 85-389: A1I_01505Help
Entry
A1I_01505         CDS       T00602                                 

Gene name
rplJ
Definition
(GenBank) 50S ribosomal protein L10
  KO
K02864  
large subunit ribosomal protein L10
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    A1I_01505 (rplJ)
Ribosome [BR:rbo03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    A1I_01505 (rplJ)
  Bacteria
    A1I_01505 (rplJ)
  Archaea
    A1I_01505 (rplJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
290094..290603
Genome map
AA seq 169 aa AA seqDB search
MLRSEKPEVVEEIASIYKDSPSVIVAHYHGLTVSEVNSLRESLKSKDAGFKVVKNTLAKI
AANKAGLDDIVSLFSGPTAIVYSKEPVEMAKLVVNFAKSNENLKIVGGIVDKQVLNEHSI
KELSKLPSLNELRSKIVGLLQAPATKIAGVLQAPSSSLARVIQANASKN
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgttaagatcagaaaaaccggaagttgtagaagaaatagcaagtatttataaagattcg
ccatctgtaatcgttgctcattatcacggattaactgttagtgaagtcaattcacttaga
gagtctcttaagtctaaagatgcaggttttaaagttgttaaaaatactttagcaaaaata
gcagcaaataaagcaggtcttgatgatatcgtaagcttattttcaggtcctaccgctatt
gtttattctaaagaaccggttgaaatggcaaaattagtagttaattttgctaaaagtaat
gaaaatcttaagattgttggcggtatagtcgataaacaagtattaaatgaacattcaata
aaagaactttctaagttaccttcattaaatgagcttagaagtaaaattgttgggttatta
caagctccggctactaagattgcaggcgttttacaagcaccgtcttcaagcttagccagg
gtaatacaagcaaatgctagtaaaaattaa

DBGET integrated database retrieval system