KEGG   Rickettsia bellii OSU 85-389: A1I_01835Help
Entry
A1I_01835         CDS       T00602                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00020  Citrate cycle (TCA cycle)
rbo00310  Lysine degradation
rbo01100  Metabolic pathways
rbo01110  Biosynthesis of secondary metabolites
rbo01120  Microbial metabolism in diverse environments
rbo01130  Biosynthesis of antibiotics
rbo01200  Carbon metabolism
Module
rbo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rbo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1I_01835
  Amino acid metabolism
   00310 Lysine degradation
    A1I_01835
Enzymes [BR:rbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     A1I_01835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABV78753
Position
356527..357729
Genome map
AA seq 400 aa AA seqDB search
MGVKIIVPSLGESVTEATIAKWYKKEGDAVKTDELLLEIETEKVTLEVNSPCNGTIGKII
KADGANVAVGEEIGDINEGEAVATNSNEAAKPQTASQPVPEKVPEKPAVANNTLAPSVQK
LVTENKLDPNNIKGTGKDGRITKGDVLETMNAPTPAATSTTSSAKASEERVERVRMSRLR
KTIAQRLKDSQNTAAILTTFNEIDMSKVIALRGKYKDEFEKKHGVKLGFMSFFVRATIEA
LKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMGFADIEKTIGGLAKK
ARDGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERVVAIDGKIEIR
PMMYIALSYDHRIIDGKEAVSFLVKIKELIESPEKLLLNL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttaaaattatagtgccgtctctcggtgaatcggtaacagaagcgactattgcc
aagtggtataagaaagagggcgatgctgttaaaaccgatgaattattattggaaattgaa
actgagaaagtaacattagaagttaattccccgtgcaatggtactataggtaaaataata
aaagctgatggagcaaatgttgcagttggtgaagaaataggcgatataaatgagggggaa
gctgtagcaacaaatagtaacgaagcagcaaaacctcaaacagcttcccagcctgttcca
gaaaaagtaccagaaaagccagcagttgctaataatacccttgctccatctgtgcagaaa
ttagttactgaaaataagcttgatccaaataatataaaaggaacaggcaaagatggtaga
attaccaaaggtgatgtattagagactatgaacgctcctactcctgccgctacttctacc
acttcttcagctaaagctagtgaggaaagagtagagcgtgtgcgtatgtcacgtttgcgt
aaaaccattgcacagcgtttaaaagactcacaaaatacagctgctattttgactactttt
aacgaaattgatatgtcaaaagttatagctctgcgtggtaagtataaagatgagtttgag
aaaaagcacggcgtaaagcttggttttatgtcattctttgttagagcaactatcgaagcg
ttaaagcttattccgtcagtaaatgctgagatagatggtgatgatttagtatataaaaat
tattacgatataggtgtagcagttggaacagaacaaggtcttgtcgtgccggttgttaga
gatgctgacaaaatgggatttgctgatattgaaaagacaataggggggctagctaaaaaa
gcaagagatggtaagctttctatggctgatttatcaggtggcacattctcgatttctaat
ggcggtgtatatggttcgcttttatctactcctattattaatccgcctcaatctggtatt
ttaggactacataaaactgaggaaagagtagtggctatagatggtaaaattgaaatacgt
ccgatgatgtatatagctctatcatacgatcaccgcataattgatggaaaggaagctgtt
tcattcttagtaaaaattaaggagctaatagaaagtcctgaaaagctactgctaaactta
tag

DBGET integrated database retrieval system