KEGG   Rickettsia bellii OSU 85-389: A1I_01910Help
Entry
A1I_01910         CDS       T00602                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
Enzymes [BR:rbo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     A1I_01910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(370204..370659)
Genome map
AA seq 151 aa AA seqDB search
MLALQLAKVLIKQFESLQLTPYYCPAGLKTIGYGHVIKPHEMLHLANKITEEDAEKLLDA
DIAEVNCVLYKYCHSSLNINQQVALISFIFNCGSTAFKNSTLLKKLNQNKYLEAADEFLK
WIYVKGKKLKGLVKRRQIERAIFLGKNTTEN
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccctacaacttgctaaagtcttaattaaacaatttgaatctctacaactaact
ccttattattgcccagcaggacttaaaacaattggttatggtcatgtaataaaacctcat
gaaatgttacatttagctaataaaataactgaagaagatgctgaaaaattacttgatgca
gatatagcagaagtaaattgtgttttatataaatactgccacagttctttaaacattaat
caacaagtagcattaatttctttcatcttcaattgtggtagcacagcatttaaaaattct
acattgcttaaaaaactcaaccaaaataaatatctagaagctgctgatgaatttcttaaa
tggatttatgttaaaggtaaaaaattgaaagggcttgttaaacgtagacaaattgagaga
gctatattcttaggtaaaaatacaaccgaaaattaa

DBGET integrated database retrieval system