KEGG   Rickettsia bellii OSU 85-389: A1I_03880Help
Entry
A1I_03880         CDS       T00602                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rbo00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rbo02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(727784..728305)
Genome map
AA seq 173 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFIANILYKPVLEPKHRGYSIAVQEVSEAPTTQAQAP
INIPELMKTANADNGREIAKKCLMCHSLDKDGPNKIGPHLWDVAGRPKASITDYKYSPAL
SALGGNWDDDSLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKTYVHDK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaactaaataaaattgttgcagctatattgtttgcaagtttaattgct
atgatggttgggtttattgcaaatatattatataaacccgttttagaaccaaaacatcga
ggttatagtattgcagtgcaggaagtttcagaagcacctactacacaagcacaagcccca
atcaatataccggaattgatgaaaacagcgaatgctgataatggtcgtgaaatagctaaa
aaatgtttaatgtgccattctcttgataaagatggtccaaataagataggacctcattta
tgggatgtagcaggtcgccctaaagcaagcataacggattataaatattcccctgcttta
tcagcccttggaggtaattgggatgatgatagtttatttgctttcttacataaaccaagt
agctatgctcctggtactaaaatgtcttttgccggtatatcaaaaccacaagatatcgca
gatgttatattatttttaaaaacttatgttcatgataaatga

DBGET integrated database retrieval system