KEGG   Rickettsia bellii OSU 85-389: A1I_03980Help
Entry
A1I_03980         CDS       T00602                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A1I_03980 (ruvA)
Enzymes [BR:rbo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     A1I_03980 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
744464..745075
Genome map
AA seq 203 aa AA seqDB search
MIGKLSGRVDSSYDDYVIIDVSGVGYRVFASAKTLSKLSEGESYKLFIETHVREDHINLY
GFLSLEEKSFFNLLQSVNGIGTRMALSILSALTPTDIQIAINNEDKNIFKAISGVGAKLA
ERIVRELSDKVAKISSSSAAIKDSLNIKGITPVASSEVIKALINMGFSRFEAQNAVQEII
TKNPEISIDELIRTALKNRNSNF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgattggtaaattaagcggtagagtcgactcaagctatgatgattacgttataatcgat
gtaagcggagtagggtatagggtttttgcttccgctaaaactttaagcaaactttcagag
ggggaatcctataaactatttattgaaacccatgttagagaagatcatattaatttatac
ggctttttgagtttagaagaaaagagcttttttaacttgctgcaatctgtaaacggtata
ggaacaaggatggctttgtctattttgtcagcccttacgcctactgatatacaaattgcc
ataaataatgaagataagaatatttttaaagcaatctcaggagtaggagctaaactagcc
gagcgtatagtacgagaattaagcgataaagtggcaaaaatatcaagctcctctgctgct
attaaagacagtttaaacattaaaggcatcacaccagtagcgagcagcgaagtaataaaa
gccttaataaatatgggcttttcaaggtttgaagcacaaaacgctgtacaagaaattatc
accaaaaatccagaaatctccatcgatgaactaatcagaaccgcactaaagaatcgtaat
tctaacttttag

DBGET integrated database retrieval system