KEGG   Rickettsia bellii OSU 85-389: A1I_04065Help
Entry
A1I_04065         CDS       T00602                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A1I_04065
Enzymes [BR:rbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     A1I_04065
Exosome [BR:rbo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A1I_04065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
762697..763674
Genome map
AA seq 325 aa AA seqDB search
MYPLIRLRRNRKAAWLRDLVAETTLRVEDLVLPLFVVEGHNQRQEIKTLPDIYRLSIDQV
IETARKAADLGIKAIALFPCIDQSLKNENGDEAYNLDNLMCRTIRSIKNAGINIGIICDV
ALDPYTTHGHDGIIHNGEVDNDKSVKALCNQALTLAKAGVDIVAPSDMMDGRIMAIREYL
DKEHFINVGILAYAAKYASSFYGLYRDAVGSTKKTYLDKASYQLDIRNIKEAMLEIEHDI
AEGADMVMVKPGMMFLDVIREAANNFNTKIFAYQITAEYAMLKFAANAGAIDFEKGLLES
LISFKRAGASGIFTYAALEAAELYL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtacccacttattagacttagaagaaatagaaaagctgcttggcttcgtgatttagtt
gctgaaactactcttagagtagaagatttggtattacctttatttgttgtggaagggcat
aatcagcgacaagaaattaaaactttgccagatatatatcgcctatctatagatcaggtg
atagaaacggcaagaaaagcagcggatctcggtattaaagctatagcactatttccctgt
attgatcaaagtttaaaaaacgagaatggtgacgaagcttataatctagataatttaatg
tgccgtactataagaagcattaaaaatgctgggatcaatattggaataatatgtgatgtt
gcacttgatccttatactacgcacgggcatgatggcataatacataacggcgaagtggat
aatgataaatcggtaaaagccttatgtaaccaagctttaactcttgcaaaagctggtgtt
gatattgttgctccttctgatatgatggatggtaggattatggctataagagaatatctt
gacaaagagcattttatcaatgttgggattcttgcctatgctgctaaatatgcttcaagt
ttttacggtttatatcgtgatgcagtcggtagtactaagaaaacttatttagataaggca
agttatcaattggacatacgaaatattaaagaagcaatgcttgagattgaacatgatata
gcagagggagctgatatggtcatggttaagcccggtatgatgtttttagatgttattcgt
gaagcagctaataactttaatactaaaatttttgcttatcaaattactgcggaatatgcc
atgttaaaatttgcagcaaatgccggagctatagatttcgaaaaaggtttattagaatca
ttaattagttttaaaagagcaggggcaagcggtatatttacttatgcagctcttgaagca
gctgaactatacctttga

DBGET integrated database retrieval system