KEGG   Rickettsia bellii OSU 85-389: A1I_06305Help
Entry
A1I_06305         CDS       T00602                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00010  Glycolysis / Gluconeogenesis
rbo00020  Citrate cycle (TCA cycle)
rbo00620  Pyruvate metabolism
rbo01100  Metabolic pathways
rbo01110  Biosynthesis of secondary metabolites
rbo01120  Microbial metabolism in diverse environments
rbo01130  Biosynthesis of antibiotics
rbo01200  Carbon metabolism
Module
rbo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A1I_06305
   00020 Citrate cycle (TCA cycle)
    A1I_06305
   00620 Pyruvate metabolism
    A1I_06305
Enzymes [BR:rbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A1I_06305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Swi5
Motif
Other DBs
NCBI-ProteinID: ABV79579
Position
1206143..1207399
Genome map
AA seq 418 aa AA seqDB search
MPIKLLMPALSPTMTEGNLARWLKKEGDKINPGEVIAEIETDKATMEVEAVDEGTLAKII
IPQGSQNVPVNSLIAVLIEEGEELSGIEEFIAKNNSNSPKKEEISKPAETIAPQNVKEEN
ITTASDQNNIKVFASPLAKRLAKIQNVRIEEIKGSGPHGRIIKQDVLSHKGGSKALSNKI
VSRNPEEYRLAPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSFGDDK
SAKISVNDFIILAVAKALQEVPNANASWGDDAIRYYNNVDISVAVAIENGLVTPIIRNAD
QKNIVDLSSEMKGLIKKARENKLTSEEFQGGGFTISNLGMYGIKNFNAIINPPQSCIMGV
GSSSKRAIVKNDQISIATIMDVTLSADHRVVDGAVGAEFLAAFKRFIESPALMLLYTR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaaacttttaatgcctgctttatctccaactatgacggaagggaatttagca
aggtggttaaaaaaagaaggggataaaatcaatcccggagaagtaatcgctgaaatcgaa
accgataaagcaactatggaagtggaggcagtggatgaaggcactcttgctaaaataatt
attcctcaaggtagtcagaacgtgcctgtgaattcgttaatagcggtattaatcgaagag
ggggaagaattatccggaattgaagaatttatagcgaaaaataacagtaactcacctaaa
aaagaagaaatatcaaaacctgctgaaactatagctcctcagaacgttaaggaagagaat
attacgaccgcttcagatcaaaacaatattaaggtgtttgcttcaccgcttgctaaaaga
ctcgcaaaaatccaaaatgtcagaattgaagaaattaaaggcagtggaccgcatggcaga
ataatcaaacaagatgtgttatcgcataaaggcggctcaaaagccttaagtaataagata
gttagtagaaatcctgaagaatatcgtttagcacctaataacaatatacgtaaaattata
gctaagcgtcttcttgaatcaaaacaaacagttccacatttttatttatcaatagaatgt
aatgttgataagttactagatataagagaagatattaataagtcttttggtgatgataaa
tccgcaaaaatatcagtaaatgactttattatcctagctgttgctaaagctttgcaagaa
gtaccgaacgctaatgcatcgtggggggatgatgctattagatactacaataatgttgat
atttcagtagcggtagcgatcgaaaatggacttgttactccgataattagaaatgctgac
cagaaaaatattgtagatctgtctagtgaaatgaaagggctaatcaagaaagctagagaa
aataaattaacttccgaagaattccaaggcggagggtttactatttcaaatcttggtatg
tatggtattaaaaatttcaatgctataattaacccgccgcaaagttgtataatgggcgtt
ggtagtagctcaaagcgtgctatagtcaaaaatgatcaaataagtatagcaacaattatg
gacgtaactctttctgctgaccacagagtagtagatggagcagttggagcagaattctta
gctgcatttaagaggtttatagaaagccctgctttaatgttgttgtatactcgatga

DBGET integrated database retrieval system