KEGG   Rickettsia bellii OSU 85-389: A1I_07215Help
Entry
A1I_07215         CDS       T00602                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00071  Fatty acid degradation
rbo00072  Synthesis and degradation of ketone bodies
rbo00280  Valine, leucine and isoleucine degradation
rbo00310  Lysine degradation
rbo00362  Benzoate degradation
rbo00380  Tryptophan metabolism
rbo00620  Pyruvate metabolism
rbo00630  Glyoxylate and dicarboxylate metabolism
rbo00640  Propanoate metabolism
rbo00650  Butanoate metabolism
rbo00900  Terpenoid backbone biosynthesis
rbo01100  Metabolic pathways
rbo01110  Biosynthesis of secondary metabolites
rbo01120  Microbial metabolism in diverse environments
rbo01130  Biosynthesis of antibiotics
rbo01200  Carbon metabolism
rbo01212  Fatty acid metabolism
rbo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A1I_07215
   00630 Glyoxylate and dicarboxylate metabolism
    A1I_07215
   00640 Propanoate metabolism
    A1I_07215
   00650 Butanoate metabolism
    A1I_07215
  Lipid metabolism
   00071 Fatty acid degradation
    A1I_07215
   00072 Synthesis and degradation of ketone bodies
    A1I_07215
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A1I_07215
   00310 Lysine degradation
    A1I_07215
   00380 Tryptophan metabolism
    A1I_07215
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A1I_07215
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A1I_07215
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A1I_07215
Enzymes [BR:rbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A1I_07215
Exosome [BR:rbo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A1I_07215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABV79743
Position
1389424..1390602
Genome map
AA seq 392 aa AA seqDB search
MIKPVYITHAKRTAFGSFMGSLSTTPAPMIATHLIKDILQNSKIDPALVNEVILGQVITG
GSGQNPARQTLIHAGIPKEVPGYTINKVCGSGLKTVALAAASIMTGDNDIVIAGGQENMS
LGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENISKQFNITREQQDEFAL
SSHQKAAKAQKAGIFKDEILPVEVTIKKTTSLFDHDETVRPDTSLEILGKLRPAFDKNGT
VTAGNASSINDGAACLMVVSEEALKKHNLTPLARIVSYASAGVDPSIMGTAPVPASQKAL
SKAGWSINDLDLIEVNEAFASQSIYVNREMKWDMNKVNVNGGAIAIGHPIGASGGRVLVT
LIHGLRRNKAKKGLVTLCIGGGMGMAMCVETI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaccggtttacatcactcatgcaaaaagaacggctttcggttcttttatgggt
agtcttagtactactcccgcaccaatgattgcgacgcacttaataaaagatattctacag
aatagtaaaatcgatccggctttagtaaatgaggtgatactcgggcaggtgatcacgggc
ggtagtggacagaatccggcaagacaaactctaattcatgcaggtattcctaaagaagtg
ccaggctatacaattaataaggtttgcggttcaggtcttaaaactgtagcacttgcagca
gcctcaattatgaccggtgataacgatattgttatagcaggtgggcaggaaaatatgtca
ctcggtatgcatggcagctatataagagcaggagctaaattcggtgatatcaaaatggtt
gatctaatgcaatatgatggattaactgatgtattctcaggagtatttatgggtattact
gctgaaaatatctcaaagcaatttaatattactagagagcaacaagatgaatttgcctta
agctcacatcaaaaagctgcaaaagcccagaaagccggaatatttaaagatgagattttg
ccggttgaagtaacaatcaagaaaactactagcttatttgatcatgatgaaacagttaga
cctgatactagccttgagattttgggtaaattacgccctgcattcgataaaaatggcact
gttactgccggtaatgcttcatcaattaatgatggtgctgcgtgccttatggtagtgtct
gaagaggctctaaaaaagcataatctaactcctcttgctcgtattgtttcttacgcttct
gccggtgttgatccaagtattatggggactgctcccgttcctgcctctcaaaaagctcta
agcaaagccggttggagcattaacgatctagatcttattgaagtaaatgaggcttttgcc
tctcaaagtatttatgttaatcgtgaaatgaaatgggatatgaataaggttaatgtgaat
ggcggagcaatagcaatcggacatccgatcggtgctagcggcggacgtgttcttgttact
ttaatacatggattaagaagaaataaagctaaaaaaggcttggtaacactatgtatcggt
ggcggtatgggtatggctatgtgcgttgaaacgatttaa

DBGET integrated database retrieval system