KEGG   Rickettsia bellii OSU 85-389: A1I_07245Help
Entry
A1I_07245         CDS       T00602                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    A1I_07245 (gmk)
Enzymes [BR:rbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     A1I_07245 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1395630..1396205)
Genome map
AA seq 191 aa AA seqDB search
MTKNKGLIIILSSPSGAGKSSLAKALLEIDHNLRLSISATTRKPRPNEQDGVNYYFKTKV
EFEKLVKQNQFLEHAKIYDNYYGTPKKHVENLLNQGLDVLFDIDWQGARSIKQNAVNAVS
IFILPPNLEVLEQRLRNRAADNEEAIQLRMASAQAEISHSNEYDHIITNDDFNDTLQQIH
TIILQERKKRN
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaataaagggttgatcataattttatcttccccatctggtgcaggtaaatca
agcttagcaaaggcattattagaaatcgatcataatctacgcttatcaatttcggcaact
actagaaaaccacgaccaaatgagcaagatggagtaaattactattttaaaactaaagtt
gagtttgagaaattagttaaacaaaatcaatttcttgaacatgctaaaatatatgataat
tattatggcacccctaaaaaacatgtcgaaaatttgttaaatcaagggctagatgtttta
ttcgatattgattggcaaggtgcaaggagtataaagcaaaatgcagttaatgccgtttct
atatttattttacctcctaaccttgaagtactggagcaacgtttaagaaatagagctgct
gataatgaagaagcaatacaactacgcatggcttcagcacaagcagaaatatcgcactct
aacgagtatgatcatataattactaacgatgattttaacgatactcttcaacaaatacat
acaattattttacaagaacggaagaagcggaattaa

DBGET integrated database retrieval system