KEGG   Rickettsia bellii OSU 85-389: A1I_07695Help
Entry
A1I_07695         CDS       T00602                                 

Definition
oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    A1I_07695
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    A1I_07695
Enzymes [BR:rbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     A1I_07695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1491307..1492086)
Genome map
AA seq 259 aa AA seqDB search
MKDKVVVITGSTSGIGFEIAKHFAKLGTKLVINGFAKDDEVKKISMELKKLGAAEIFYQG
VNLEKPSEIKSMFENIVKEFGKIDILVNNAGIQHVAPIDEFPEDKWEQILRIDLIASFYT
TKYAIPIMKKNGFGRIVNIASAHAYVASPFKSAYVAAKHGILGLTKTVALEVAENNITVN
AICPGYVNTPLVKNQIADTAKARHISEESALKDVILKSQATKKFVEASEIADLVIFLCDE
KASSITGAGLLIDGGWTAQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaagtagtagttataaccggttcaacaagtggtattgggtttgaaatagcc
aagcattttgcaaaacttggtactaaattagttattaatggttttgcaaaagatgatgaa
gtgaaaaaaatttctatggaattaaaaaagcttggtgcagctgaaatattttatcaagga
gtaaatcttgaaaagccgagtgaaataaaatctatgtttgagaatatagtaaaagaattc
ggaaaaatagatatattagtgaataacgcaggcattcaacatgttgcccctatcgatgag
tttccagaagataaatgggaacagattttgcgtatagatttaatagcatctttctatact
acaaaatacgctattcctataatgaaaaagaacggctttgggcgtatcgtcaatatcgct
tcagctcacgcatacgttgcatccccttttaaatccgcatatgtggcagcaaagcacgga
atccttggattaactaaaactgttgctttagaggtagctgagaataatattaccgttaat
gctatctgccctggttatgtaaatactcctcttgtaaaaaaccaaatagcagatactgca
aaagctcgccatattagcgaagaatcagccttaaaagacgtaatattaaaatcacaagcc
acaaagaaattcgtggaggcaagcgaaatagctgatttagtaatatttctatgtgacgaa
aaagcatcatctataacaggagctggactcttgatagatgggggctggacagcacaataa

DBGET integrated database retrieval system