KEGG   Rickettsia bellii OSU 85-389: A1I_07900Help
Entry
A1I_07900         CDS       T00602                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rbo01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rbo00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1520347..1521522
Genome map
AA seq 391 aa AA seqDB search
MHTTYLKNLIGFESLTPQSNGAIEYIDDLLKEHGFKTEVKIFGETEQVTNLYAVYGNSKP
NICFVGHVDVVPAGDPNLWHNSNPFKAHEQEGKIYGRGTVDMKGSIACFLAASLDFIKNN
TDFVGSISFLLTSDEEGKAKHGTKEMLQYIYNQGHEIDFAIVGEPTCEKEIGDTIKIGRR
GSINFKLAVKGLGGHVAYPQKANNPLPCLIRILNELTNIKLDKGTEFFQNSNLEVTNIDV
DNNTTNVIPETATVHFNIRFNNLHSAETLAKQVEEIIKQHCQKHKLDYTLEYNSSADSFI
QNPNDKIKEFATIVEKTLNIKPNFSTSGGTSDARFVKNYCPLVEFGLLSDTAHKINEYTK
ISDLQKLYDVYYNFLMETLNVTGSPPLLGMT
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcacactacctacctaaaaaacttgatcgggttcgaatccctaactccccagagtaac
ggagctattgaatatattgacgatttgcttaaagaacatggctttaagaccgaggtaaaa
atttttggtgagaccgagcaagttactaatctttatgctgtttatggcaatagtaaacct
aatatttgctttgttgggcatgttgatgtagttcctgctggtgatcctaacctttggcac
aattctaatccctttaaagctcatgagcaggagggaaaaatatatggtagagggacggtt
gatatgaaagggtcaattgcatgttttttagcagctagcttagacttcataaaaaataat
accgattttgtaggctctattagctttttacttactagcgatgaagagggaaaggcaaag
cacggcactaaggagatgctacaatatatatataatcaaggacacgaaattgattttgct
attgttggcgaacctacttgcgaaaaagagataggggacacaattaaaattggcagaaga
ggaagtattaattttaagttggctgtaaaaggcttaggtgggcatgtagcttatccgcaa
aaagcaaataatccattaccttgcttgataagaatattaaacgaactaacaaatattaaa
cttgataaagggactgaattttttcaaaattcaaacctcgaagtaacaaatattgacgtt
gataataatactacaaatgtgattcctgaaacagcaactgtacattttaatatacgtttt
aataacttacatagtgcagaaactctagcaaaacaggtagaagaaattattaaacaacac
tgccaaaagcataaattagattatacgctagaatataatagctctgccgatagttttatt
caaaatcctaatgataagataaaagaatttgctacaatagtagaaaaaactcttaatata
aaaccaaatttttctacaagcggcggtacatccgatgcaagatttgttaaaaattattgc
cccttagtagaattcggtttattatcagacactgcacataaaataaatgaatataccaaa
attagcgatttacaaaaattatacgatgtgtattataattttttaatggaaacattaaat
gttactggatccccgccgttgctgggaatgacataa

DBGET integrated database retrieval system