KEGG   Ruminococcus bromii: RBR_03880Help
Entry
RBR_03880         CDS       T02599                                 

Definition
acetaldehyde dehydrogenase/alcohol dehydrogenase AdhE (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
rbr  Ruminococcus bromii
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rbr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RBR_03880
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBR_03880
   00620 Pyruvate metabolism
    RBR_03880
   00650 Butanoate metabolism
    RBR_03880
  Lipid metabolism
   00071 Fatty acid degradation
    RBR_03880
  Amino acid metabolism
   00350 Tyrosine metabolism
    RBR_03880
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RBR_03880
   00626 Naphthalene degradation
    RBR_03880
Enzymes [BR:rbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RBR_03880
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RBR_03880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(393087..395708)
Genome map
AA seq 873 aa AA seqDB search
MSTKEYPIVDNAESFEAALARVREAQKIFATYTQEQVDKIFLAAATAANQMRIPLAKMAV
EETGMGVAEDKVIKNHFASEYIYNAYRNVKTCGVLEEDKAYGIKKIAEPIGVIAAVIPTT
NPTSTAIFKTLVCLKTRNGIIISPHPRAKKSTIEAAKVVLEAAVKAGAPEGIISWIDIPS
LELTNTLMQEADCILATGGPGMVKAAYSSGKPALGVGAGNTPAIIDETADILLAVNSIIH
SKTFDNGMICASEQSVIVEKKIYSKVKKEFKARGCYFLNEEETEKVRKTIIINGALNAKI
VGQKPVTIAALAGVTIPEETKVLIGEVESVDISEEFAHEKLSPVLAMYKAEDFEDAIAKA
EHLIADGGYGHTSSLYVDAVNERAKIDEFASRMKTCRILVNTPSSQGGIGDLYNFKLTPS
LTLGCGSWGGNSVSENVGCKHLINIKTVAERRENMLWFRAPEKVYIKRGCMPVALQELKD
VMGKKRAFIVTDSFLYKNGYTKPITDKLDEMGITYTTFADVEPDPSLISAQKGAEAMRKF
EPDCIIALGGGSAMDAGKIMWVLYEHPEVDFQDMAMRFCDIRKRVYTFPKMGEKAYFIAI
PTSSGTGSEVTPFAVITDQNTGVKYPLADYQLMPKMAIVDANNMMSGPKGLTAASGIDAV
SHALEAYASMMATDFTDGLALRSLKLIFEYLPACYDNGMNEPVAREKVAHAATMAGMAFA
NAFLGVCHSMAHKLGAFHHVPHGIANALMLEQVIRFNSAEVPAKMGTFPQYDHPHTLARY
AEVARYLGLGGKNDTESVENLIKAVNDLKARVGIKNSIKDYVPDEEDFLNRLDAMTEQAF
DDQCTGANPRYPLFKEIKQMYLNAYYGNNSETV
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaaaagagtatcctatcgtagataacgcagaaagctttgaagctgcccttgca
agagtaagagaagctcagaaaatttttgctacctacacacaggagcaggttgacaagatt
tttcttgctgccgctactgctgctaaccagatgagaattccgctcgctaagatggctgtt
gaagaaacaggcatgggcgttgcagaagataaggttatcaagaaccacttcgcatctgag
tatatttacaatgcttacagaaatgttaagacttgcggcgttcttgaggaagacaaggct
tacggcattaagaagattgctgagccaatcggtgtaatcgctgccgttattcctacaaca
aacccaacttcaaccgctatctttaagacactcgtttgtcttaaaacaagaaacggtatc
atcatcagcccgcatccccgtgctaagaagagcacaattgaggctgccaaggttgttctt
gaagctgctgttaaggcaggcgctccggagggtatcatcagttggattgatattccttca
ctcgaactcacaaacacacttatgcaggaagctgactgcatcctcgcaacaggcggcccc
ggcatggttaaggctgcttattcatcaggtaagcctgcactcggtgttggcgccggtaac
acacctgctatcattgatgaaacagctgacattttactcgcagttaactcaattatccac
tcaaagacatttgataacggtatgatctgtgcttcagagcagtctgttatcgttgaaaag
aagatttacagcaaagttaagaaggaattcaaggctcgtggctgctacttccttaacgag
gaagagacagagaaggttagaaagactatcatcatcaacggcgctcttaacgctaagatt
gttggtcagaagcctgttacaatcgcagctcttgcaggtgtaacaattcctgaggaaaca
aaggttcttatcggtgaggtagaatcagttgacatcagcgaagagtttgctcacgagaag
ctttctcctgtactcgctatgtacaaggctgaagattttgaagatgctattgcaaaggct
gagcaccttattgctgacggcggttacggtcacacatcttcactttatgttgacgctgta
aacgaaagagcaaagattgacgagttcgcatcaagaatgaaaacttgccgtatccttgtt
aacacaccttcttcacagggtggtatcggtgacctttacaacttcaagcttactccttca
ctcacactcggctgtggttcatggggcggcaactctgtttctgagaatgttggttgcaag
caccttatcaatattaagacagttgccgagaggagagaaaatatgctttggttcagagca
cctgaaaaggtttatatcaagaggggctgtatgcctgtagctcttcaggaactcaaggat
gtaatgggtaagaagagagcattcatcgttactgactcattcctttataagaatggctac
acaaagccaatcacagacaagctcgatgaaatgggcatcacatatacaacattcgcagat
gttgagcctgacccatcacttatttcagctcagaagggtgcagaggctatgcgtaagttt
gagcctgactgcattatcgcactcggcggcggttcagcaatggatgccggcaagattatg
tgggttctctatgagcatccggaagttgacttccaggatatggctatgcgtttctgcgat
atccgtaagagagtttacacattcccgaagatgggtgagaaggcatacttcattgctatc
ccaacatcatcaggtacaggttctgaggttactcctttcgcagttatcacagaccagaat
acaggcgttaagtatccgcttgctgactatcagcttatgcctaaaatggcaatcgttgat
gctaacaacatgatgagcggtcctaagggacttacagctgcatcaggtatcgacgctgtt
tctcacgcacttgaggcttatgcttcaatgatggctacagacttcacagacggtcttgca
ctccgttcactcaagcttatcttcgagtatctccctgcttgctatgacaacggtatgaac
gagcctgttgctcgtgagaaggttgctcacgctgctacaatggcaggtatggcattcgct
aacgcattcctcggtgtttgtcactcaatggctcataagctcggtgctttccatcatgta
ccgcacggtattgctaacgcacttatgcttgagcaggtaatcagattcaactcagcagaa
gttcctgctaagatgggtacattcccacagtatgatcacccacacacacttgctcgttat
gctgaagtagctcgttacctcggcctcggcggcaagaacgatacagagagcgttgaaaac
cttatcaaggctgttaacgacctcaaggcaagagttggcatcaagaactctatcaaggat
tatgttccggacgaagaggacttcctcaaccgtcttgacgctatgacagagcaggcattt
gatgaccagtgcacaggtgcaaacccaagatatccgctcttcaaggaaatcaagcagatg
tacctcaatgcttactatggcaacaacagcgagactgtttaa

DBGET integrated database retrieval system