KEGG   Ruminococcus bromii: RBR_05570Help
Entry
RBR_05570         CDS       T02599                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rbr  Ruminococcus bromii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RBR_05570
Enzymes [BR:rbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RBR_05570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(599492..600979)
Genome map
AA seq 495 aa AA seqDB search
MARSAGVLLSITSLPSPYGIGTIGKEARKFADFLKKSGQTIWQILPVGPTSYGDSPYQSF
STYAGNPYLIDLDTLCEEGLLTKEEVMSRDWGSDDAEVDYEKIYNNRFEVLKIAYDNFKK
GDQKAFTSFKRKNSSWLKNYALYMAVKKSFDMVSWTEWPDEEIKMRDEAAVKRYERKLKD
DVDFWKFVQFKFYEQWESFRAYVNGLGIKILGDMPIYVAMDSADTWANPELFQLYDDGDP
IAVAGCPPDYFSATGQLWGNPLYDWDYLEATDYEWWFERIKAASKLYDITRIDHFRAFAS
YYSIPYPAENAINGEWVEGPRIKFFNMMEEALGKIDIVAEDLGTLTPDVTELMEQTGYPG
MKVLEFAFDSGEENDYLPHKYTENCVVYTGTHDNDTVMGWLETAKPEDVNYARSYCQMPD
DEPFNWGLIRVAYESKADTAIVPMQDILGLGKEARMNIPSTLGGNWVWRLDGAALTDELA
DKLKTMSEKSGRLED
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggctagaagcgcaggtgttctcctttcgattacttcgcttccatccccctacggtatc
ggcaccatcggcaaagaggctcgcaagtttgctgactttctgaaaaaatcaggtcagaca
atctggcagattctccccgttggaccgacaagttacggtgattcaccgtatcagtctttt
tcaacctatgcaggcaatccttacctcattgaccttgacactctttgtgaagaaggtctt
ttgactaaggaagaggtcatgagccgtgactggggctcagatgacgccgaggttgactat
gagaaaatctacaacaaccgttttgaagttttgaagattgcttacgataacttcaaaaag
ggtgaccagaaggcatttacatccttcaagcgtaaaaacagttcatggctcaaaaactat
gcactttatatggcagttaaaaagagctttgacatggtttcctggacagaatggccggat
gaggaaatcaaaatgcgtgatgaggctgccgtgaagcgttatgaacgcaagctcaaggat
gatgttgatttctggaagtttgtacagttcaaattctatgagcagtgggaatccttccgt
gcgtatgtaaacggtctcggcatcaagattttgggcgatatgccaatctatgttgccatg
gacagcgcagacacatgggcaaatcccgagctgtttcagctttatgacgacggtgatccc
atcgcagttgcaggctgtccgccggattacttctcggcaacaggtcagctttggggcaat
cctctctatgattgggattaccttgaggctaccgactatgagtggtggtttgagcgtatc
aaagccgcatcaaagctttatgacatcacccgtattgaccatttcagagcttttgcaagc
tactattcaattccttatcctgccgaaaacgcaatcaacggtgaatgggttgaaggtccg
cgcattaagttctttaatatgatggaagaggcactcggcaagattgatattgttgccgaa
gacctcggaacactcactcccgatgtaaccgagcttatggagcagacaggctatccggga
atgaaggttcttgaattcgctttcgacagtggtgaagagaacgactatcttccccataaa
tacaccgaaaactgtgttgtttacacaggtactcacgataacgatactgttatgggctgg
cttgaaacagctaaacccgaggacgttaactatgcaagaagttattgtcagatgcctgat
gacgaaccattcaactggggactcatccgtgttgcttatgaaagcaaggcagatacagca
atcgtacctatgcaggatattctcggccttggcaaggaggcaagaatgaatattccgtca
acactcggcggaaactgggtatggagactcgatggtgcagctcttactgatgagcttgct
gataaattaaaaactatgtctgaaaaaagcggacgactggaggactaa

DBGET integrated database retrieval system