KEGG   Ruminococcus bromii: RBR_06780Help
Entry
RBR_06780         CDS       T02599                                 

Definition
Glycosidases
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
rbr  Ruminococcus bromii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RBR_06780
Enzymes [BR:rbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RBR_06780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(720529..724599)
Genome map
AA seq 1356 aa AA seqDB search
MKKRSMKRALSAVLTLCMALPGASVAFGSASAATVSDDSSTSASSTAAGSLVEDDGFTWD
NANVYFLLTDRFKNGNTANDHSYGRTLDKDGKPLEGWDTNPGTFHGGDFAGVTQSIEEGY
FDNLGVNAIWISAPYEQTHGYCDSGKGFAHYSYHGYYVLDYTETDANFGTKEEFKTLVDT
AHEHGIRVIMDIVMNHTGYNTVADMEQFGFGTLLDGALDFKYKLTDVGEVNDHIDYKTSE
EDWGKWWSNDWIRSGLPGYTEGAGGDLTMSLSGLPDFRTEQTKDVTIPPILKTKWTQEGT
YAQKLAKYGDKNTVTGYLSTWLSEWVREYGVDGFRCDTAKHVDKASWNQLKQACVSALRE
WRSNNKGKAGADWKEDFWMTGEHWDHGVGYDTYYSEGGFDSMINFAVTGGGALASGSVAN
TYQGYADKINTKEGFNVLSFMSSHDETLTRGDENTMLYNAAAFLLLPGGVQIFYGDETNR
PLYPGVAFDGYGGSGHALRSDMNWNDMDKTLLAQWQKVGQFRNKHVSIGAGANVKLSATS
GVAFGRTYDKNGVTDQAAAVIGCNKNSSVTVDVSTLWEDGSYVINTYDNSSSVVTDGKVT
FNSGVNGTILMENADGQPLVSITGEPKFYGTEQVTVSLKECDSAKVSVDGGNKFVVKDGD
TFTIGQTAYKNDTIEVTVEATNDKASSEAKFTFLKLGENDEKPTTSPTQSTTVPGSTASQ
TSKLTIKSTAGAPNVYAWTGASTALNGAWPGQKAAAVSGQANTYELTLPVSADKSFSVVL
NNGSGSQSGDITGLYDGAVLEIQNGNYASVKTVTNGNQQGGGGEPEPAEGSVSVTIKPYS
PSASYKIYAWNDTQKLTGAWPGVALTEKDSDGNYVVKFDNVDEVSIILSSGSGQTADITG
VRDGATIEITNEGCTTYKLTSKPIVVSPYESLKKEARKILAMTASDYTAESWANAQKVLK
SAEAMIKAGEDATTAEDMNAMIADLKSAQKALVLAPATLTYAVVGKSVVSGVTASAAKVT
VTVDGKTYTATADDVTGAFTVATSALKGTSTIKVDATRNGVNGTYSYAMKNGNIENGFVP
TSPTLPTQPTTSTQPTTATQPTTATQPTAPTQPTTATEPTTAPAQKLTVNATSNYFGSAS
KTVSTDGKKVTVLYKLNSNMGVVDGQWAVKYDSSKLKFNMADNKADGKQTIMPSQSNLIH
NAYSNVIKGVFTNPQVPTQYNGDTFISLTFEVIGSGTASVYLDTQYLTLGYVKGNKLNQA
SVVNNSKVCDVTGIAGFEKVSVNASTAFVGDVTLGDVNMDGDITVVDATEVQRYVAQLVA
FTNDQFTAADVDHDGTITVKDATTIQKFVVDLISNF
NT seq 4071 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagaagtatgaagagagcgctcagtgccgttttgacactttgtatggctctc
cccggtgcttccgtagcatttggttcggcaagtgctgcaacagtttccgatgacagcagc
acatctgcatcatcaactgccgcaggttcacttgttgaagatgacggttttacatgggat
aatgccaatgtgtatttcctgcttaccgaccgttttaagaacggaaacaccgcaaatgac
cattcatacggcagaacacttgacaaggacggcaaaccgcttgagggctgggatacaaac
cccggtacattccacggcggcgactttgcaggtgttactcagtcaattgaagagggttat
tttgataacctcggtgtaaacgcaatttggatctcagctccgtatgagcagactcacggc
tattgtgattcaggtaagggctttgctcactactcatatcacggctactatgttcttgac
tataccgaaaccgatgcaaacttcggtacaaaagaggagttcaaaactcttgttgacaca
gcgcatgagcacggtatcagagttatcatggatatcgtaatgaaccacacaggctacaac
accgttgcagatatggagcagttcggcttcggtactctccttgacggtgcgttagacttc
aaatacaagctcacagatgtaggtgaagtaaacgaccacattgactataaaacatcagaa
gaagactggggcaaatggtggagcaatgactggatccgcagcggtcttcccggatataca
gagggtgccggcggtgatcttacaatgtcactcagcggacttcccgacttcagaacagag
cagacaaaggatgttacaattcctccgatcctcaaaacaaagtggactcaggaaggtaca
tatgctcagaagctcgcaaaatacggtgacaaaaacacagtaacaggctacctttcaacc
tggctttcagagtgggttagggagtacggtgttgacggtttccgttgcgatactgcaaag
catgttgataaggcttcttggaaccagctcaagcaggcttgtgtttctgctctcagagag
tggagatccaacaacaagggcaaagcaggtgctgactggaaagaagatttctggatgaca
ggcgagcattgggatcacggtgtaggctacgacacatactattccgagggcggcttcgac
tcaatgattaacttcgcagttacaggcggcggtgctcttgcaagcggtagtgttgcaaac
acatatcagggctatgcagacaagatcaacacaaaggaaggctttaacgttctttcattt
atgtcatcacacgatgaaacacttacccgtggcgatgagaacacaatgctttacaatgcg
gctgcattcctccttctcccgggcggagttcagattttctacggtgacgaaaccaaccgt
cctctctatcccggcgttgcatttgacggttacggcggatcgggtcacgcactcagaagt
gatatgaactggaacgacatggacaaaactcttcttgctcagtggcagaaggttggtcag
ttccgtaacaagcacgtatctatcggtgccggcgcaaatgttaagctctcagctacaagc
ggtgttgctttcggccgtacatacgataagaacggcgtaacagatcaggcagctgcagta
atcggctgtaacaaaaattcaagcgtaactgttgatgtttcaactctttgggaagacggc
agctatgtaatcaatacttatgacaactcatcttcagttgttactgacggtaaggtaact
ttcaacagcggtgtaaacggcacaatccttatggaaaatgctgacggtcagccgcttgta
tcaatcacaggcgagccgaagttctacggcacagagcaggttactgtttctctcaaggaa
tgcgacagcgcaaaggtttctgttgacggcggtaacaagtttgttgttaaggacggcgac
acattcacaatcggtcagacagcttacaagaacgatacaatcgaagtaactgttgaggct
acaaacgacaaggcaagctcagaggctaaattcacattcctcaagctcggcgaaaacgac
gaaaagcctacaaccagcccgacacagagcacaactgttcccggttcgacagcaagtcag
acatcaaagcttacaatcaagagcacagcaggcgctccgaatgtttacgcttggacaggt
gcaagcacagcactcaacggtgcatggccgggtcaaaaggcagcagccgtttcaggtcag
gcaaacacatatgaactcacacttcctgtttcagctgacaagtcattcagcgttgttctc
aacaacggcagcggctcacagtcaggcgatatcacaggtctttatgacggtgctgttctc
gaaattcagaacggcaactacgcatcggttaagacagtaaccaacggtaatcagcaggga
ggcggcggcgagccagagcctgcagagggttctgtttccgtaacaatcaagccttacagc
ccatctgcaagctacaaaatttacgcttggaatgatacacagaagctcacaggcgcatgg
ccgggcgttgctcttacagaaaaagattctgacggcaactatgttgttaagttcgataat
gttgacgaagtaagcattattctcagcagcggttcaggtcagacagcagatatcacaggc
gttagagacggcgctacaatcgaaattacaaacgaaggttgtacaacatacaagcttaca
tcaaagccaatcgttgtttcaccttatgaatcactcaagaaagaagcaagaaagattctt
gctatgacagcatcagactacacagcagagagctgggcaaatgctcagaaggttctcaag
tcagccgaggctatgattaaagcaggcgaagacgctacaacagctgaagatatgaatgct
atgattgcagacctcaagtcagctcagaaggcacttgtacttgctcctgcaacactcaca
tatgcagttgtaggcaagagcgttgtatcaggtgttacagccagcgctgcaaaggtaact
gttacagttgacggtaagacatatactgctactgcagacgatgtaacaggtgcattcaca
gttgcaacatcagctctcaagggaacaagcacaatcaaggttgacgcaacaagaaacggt
gtaaacggcacatattcatatgctatgaagaacggcaacattgaaaacggatttgttcca
acatctcctacacttccgacacagcctactacttcaactcagccgactacagctacacag
ccaacaacagctactcagccgactgcacctacacagcctacaacagctacagagccgact
actgctcctgctcagaagctcacagtaaacgctacttcaaattactttggttctgcatca
aagacagtaagcactgacggcaagaaggtaactgttctctacaagctcaactcaaacatg
ggcgttgttgacggacagtgggctgttaagtatgattcaagcaagctcaaattcaacatg
gctgataacaaggcagacggcaagcagacaatcatgccttcacagtcaaaccttattcac
aatgcttacagcaatgtaattaagggtgtatttactaacccacaggtgcctactcagtac
aacggagatacatttatctcactcacatttgaggttatcggttcaggtactgcaagcgta
tatcttgacacacagtaccttacattaggttatgtaaagggcaacaagcttaatcaggca
tctgttgtaaataacagcaaggtttgcgatgtaacaggcattgcaggctttgaaaaagta
tcagtaaacgcatcaacggcatttgtcggcgatgtaacccttggtgatgttaacatggac
ggcgacatcacagttgtagatgcaaccgaagttcagaggtatgttgctcagctcgttgca
ttcacaaacgaccagtttactgctgccgatgttgaccatgacggcacaatcacagttaag
gatgctactactattcagaagtttgttgtagacctcatcagcaacttttaa

DBGET integrated database retrieval system