KEGG   Ruminococcus bromii: RBR_17620Help
Entry
RBR_17620         CDS       T02599                                 

Definition
(GenBank) Cellulase M and related proteins
Organism
rbr  Ruminococcus bromii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1843249..1844277)
Genome map
AA seq 342 aa AA seqDB search
MNTKELIFELCCAMGVSGREEPALSVAEKFLSDYTDDIKISNGSLMAVCGNKNSDKTILL
DAHIDRIGFMVTEINENGFVKVSPCGGIDARTLADTLLCLQNNPDVTGVVCCMPPHLSDG
KEDKAMPTDKIWVDFGLPYDEVNKLISFGDMLTFASKPANLLNGRIVAPCLDNRCGVASL
VKCTELLKDNETDYKVIILLSSQEETFGTGAKTGAFTVEADESIVVDVSFASQPDVSGFY
SSVELDKGPMICISSILNKEMSKSLESVAKNKNIPYQLEPIAGRTGTNADHISISGKGVK
TAVVSIPQRYMHTQNEVISVADVDNTAKLIAEYIKCGGAFND
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaaagaacttatttttgaactctgttgtgcaatgggtgtgtcgggcagggaa
gaacccgctttgtctgttgccgaaaagtttttatcggactacacggatgacataaagata
tcaaacggcagtcttatggctgtttgcggtaacaaaaattcagataaaaccatattgctt
gacgctcacattgaccgtataggatttatggttaccgaaataaatgaaaacggatttgta
aaagtttctccgtgcggaggaattgacgcaagaactcttgccgatactctgctttgtctg
cagaacaatcctgatgtaacaggtgttgtatgctgtatgcctcctcatctttccgacgga
aaagaggacaaggctatgccaaccgacaaaatctgggttgatttcggtctgccgtatgat
gaagttaataaactcatttcattcggtgatatgctgacatttgcctcaaagccggcaaat
cttttgaacggcagaattgttgcgccttgccttgataacagatgcggtgttgcatcactt
gttaagtgtacagagttattgaaagacaatgaaacagattataaagtaattatcctttta
agctctcaggaagaaacatttggcacaggcgctaaaacaggtgcttttacagttgaagca
gacgagtcaattgttgttgatgtaagctttgcatctcagccggatgtttcagggttctat
tcttcggttgaactcgacaaaggaccaatgatttgcatttcttcaattctcaacaaagaa
atgagcaaatcgcttgaaagcgttgcaaagaataaaaatataccgtatcagcttgaaccg
atagcaggcagaacaggtacaaatgccgaccatatttcaatcagcggaaaaggtgtaaaa
actgctgttgtatcaatcccacagcgatatatgcatacacagaatgaagttatttctgta
gctgatgttgacaatacggcaaagcttattgccgaatacattaaatgcggaggtgctttc
aatgattga

DBGET integrated database retrieval system