KEGG   Roseiflexus castenholzii: Rcas_0301Help
Entry
Rcas_0301         CDS       T00585                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rca  Roseiflexus castenholzii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rcas_0301
Enzymes [BR:rca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Rcas_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
376114..376791
Genome map
AA seq 225 aa AA seqDB search
MTYHNGNNGHHDHALADVDEREYETLIIQGRGKLEGMSYHSDAAIEDAVRVILKQIGENP
EREGLQKTPSRVAKMYAELTAGYHIDPDALINEAVFSVGYDEMVLVKNIEFSSLCEHHML
PFMGRVHVAYIPNGRVVGLSKIPRIVEMFARRLQVQERMTVQIADFINQRLEPLGVAVVA
EGVHMCAVMRGVKKAGATMVTSAMRGVFRDDPKTRSEFMAHIERG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcacaatggcaacaatggacaccacgaccatgcgctcgcagacgtggacgag
cgcgaatacgaaaccctgatcatccagggacgcggcaaacttgaaggaatgagttatcat
tccgacgcagcgattgaagacgccgtgcgagtcattctgaagcagatcggcgaaaatcct
gaacgtgaggggttgcagaagacgccgtcgcgcgtcgccaaaatgtacgcggaactgact
gccgggtaccatattgatcccgacgcgctgatcaacgaagcggtcttcagcgtcggctac
gatgaaatggtgctggtcaagaatatcgagttctctagtctgtgcgagcaccatatgctt
ccttttatggggcgggtgcacgtcgcgtacattcccaacggcagagtcgtggggttgagc
aagattccgcgcattgtcgagatgttcgcgcggcgcttgcaggtgcaggaacggatgaca
gtacagatcgccgattttatcaatcagcggctcgaaccactgggcgtggcggtcgtcgcc
gagggcgttcatatgtgtgcagtgatgcgcggtgtcaagaaagccggcgccaccatggtc
acatccgcgatgcgcggggtcttccgcgatgatccgaagacacgcagtgagttcatggcg
catatcgagcggggatga

DBGET integrated database retrieval system