KEGG   Roseiflexus castenholzii: Rcas_0489Help
Entry
Rcas_0489         CDS       T00585                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rca  Roseiflexus castenholzii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rcas_0489
Enzymes [BR:rca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Rcas_0489
Peptidases [BR:rca01002]
 Cysteine Peptidases
  Family C44
   Rcas_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(630340..632340)
Genome map
AA seq 666 aa AA seqDB search
MCGIVGIVNVQGDHPITEEMLRQMLALIRHRGPDQFGIYLDDRAGLGNARLSIIDLSGGQ
QPIASEDEGLWIVFNGEIFNYVELRPDLEARGHRFTTNTDTEVILHLYEEYGPACLSHLN
GQFAIAIWDAHEQTLFLARDRVGILPLFYTIVDGTLIFASEIKAIIADPRVQRAIDPVAL
EQIFTFWGTLSPRTIFRGIVDLPPGHYLIARRGRIDVQPYWRLEFGAPTEARREEEYVEE
LRDLLIDATTIRLRADVPVGAYLSGGLDSSTVAAIVRQYADNRLDTFSIAFSDPEFDESR
FQRQMAQCLGTNHQVAYVTHADIGRVFPEVIWHTETPILRTSPAPLFILSQLVRDHSYRV
VLTGEGADEFLAGYDIFKEAKVRRFWARQPSSRLRPLLLRRLYPWIAGFAGKNVAYLAAF
FSEGLMDTTAPDYSHRPRWRTTSRTRRFFSDDVRQAADTLAQSTDRAPYYPEAFSSWDPL
QQAQYLEITTFLSQYLLSAQGDRMIMAHAVEGRFPFLDHRVIEFASRLPPCLKLRGLTEK
YILRRVGRAWLPDAIWQRPKQPYRAPIHRSFFNDARLDYVQHLLSPDQVQANGLFKPTAV
AHLKEKAQSGVRLSETEDMALVGILSTQLLVERFIHEFRLPPPISEADSVRVCIRNGITV
GGTYGI
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgtgggcatcgtcaacgttcagggtgatcacccgattaccgaagaaatg
ctgcgccagatgctggcgttgatccggcaccgcggtcctgatcagtttggcatctatctc
gacgaccgtgccgggttgggcaatgcgcgactgagcatcatcgatctgagcggcggtcag
caaccgattgccagcgaagatgagggtctctggatcgtcttcaacggcgaaatcttcaac
tatgtggaactgcgtcccgatctcgaggcgcgcgggcaccgcttcacgaccaataccgat
accgaggtgattctgcacctgtatgaagagtacggtccggcatgcctttcccatctcaac
gggcagtttgcgatcgccatctgggacgcgcacgaacagacactcttcctggcgcgcgac
cgggtcggcatcctcccactgttctataccatcgtcgatggcacgttgatcttcgcgtcg
gagatcaaggcaatcatcgctgatccgcgcgtgcaacgcgccatcgaccccgtggcgctg
gagcagattttcacgttctggggaacgctctcgccgcggaccatttttcgtggcatcgtg
gatctgcctccaggtcattacctgattgcgcgacgcgggcggatcgatgttcaaccgtac
tggcggctggagttcggcgcgccaaccgaagcgcgccgcgaggaggaatatgtcgaggag
ttgcgcgatctcctgatcgacgccacaacgatccgtctgcgcgcggatgtgccggtcggg
gcatacctcagcggcggactggactcctcgacagttgcagcaattgtgcgccagtacgca
gataatcgcctcgataccttttcgattgccttcagcgacccggagttcgatgaaagtcgc
ttccagcgccagatggcgcagtgccttggcacgaaccatcaggtagcgtatgtgacgcac
gccgatattgggcgcgtcttcccggaggtgatctggcacacggaaacgccaatcctgcgc
acatcgccggcgccgctcttcattctctcgcaactggtgcgcgaccattcctaccgtgtg
gtgctgaccggcgaaggcgccgatgaatttctggcaggctacgacattttcaaagaagcg
aaggtgcggcggttttgggcgcgtcagccgtcttcgcgcctgcgaccgttgctattgcgg
cgcctgtatccctggatcgccgggtttgccggcaagaatgtcgcctatctggcggcgttc
ttcagtgaaggattgatggatacgaccgcgccagactactcacaccgtccgcgctggcgc
accaccagccgcacccgccgattcttcagcgacgacgtgcgtcaggccgccgatacgctg
gcgcaatccacggatcgcgcgccatactacccggaagcgttcagttcgtgggatccgctc
cagcaggcgcagtatctggagatcaccacgttcctttcgcaatacctcctctctgcccag
ggagaccggatgattatggcgcacgcggttgaggggcgctttcccttcctcgatcatcgt
gtcatcgaatttgccagtcgcctgccaccgtgcctgaaactgcgcggtctcaccgagaag
tacatcctgcgccgggtcggtcgtgcctggctgccagacgccatctggcagcgtcccaag
caaccgtaccgcgcgccgatccatcgcagtttcttcaacgatgcgcgcctggactatgtt
cagcatctcctctcgccggatcaggtccaggcgaacggtctgttcaaaccgacggcggtg
gcgcacctgaaggagaaagcacagtccggcgtccgcttgagtgaaaccgaagacatggcg
ctggtggggattctctcgacccaactgctggtcgagcggttcattcacgaatttcgttta
ccgccgccaatctccgaagcagacagtgtcagagtctgcattagaaacggcatcaccgtg
ggaggaacttatgggatttga

DBGET integrated database retrieval system