KEGG   Roseiflexus castenholzii DSM13941: Rcas_0505Help
Entry
Rcas_0505         CDS       T00585                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rca  Roseiflexus castenholzii DSM13941
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
653563..654660
Genome map
AA seq 365 aa AA seqDB search
MQRFVHFFSLALLIAVFITVIRGDSPIARTPAPGESPQAMIALGRRLFYDRRLSANEQIA
CAACHRQELGFSDGRVVSNGATGALLRRNTPGLFNSGELLAFTWANVEVRTLEQQVERAL
FTVDPPEMWVRGYETTVIDRLRADPEYLRQFTAAFPADDDPFTWRRITGALAAFVRSLAA
RNTPYDRYVYAGDRAALSDSAQRGMALFFSPGLACGHCHVDVPSPERATPPRWSDLAYVA
TGAGYSADRGLAEQTGNPADAYRFRVPPLRNVAVTAPYMHDGSLPTLEAVIRFYESGGRW
GAGVEPERVAARHPLIAGFALSDEERRDLIAFLEALTDDEALRNPAFADPFLSDARTPSV
RSLSR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcttcgtccatttttttagcctggcgctattgattgctgtgttcatcacagtg
atacgcggagattcgcctattgccagaacgccagcccccggcgagtcgccgcaggcgatg
attgcattgggacgccggctcttttacgaccgacgcctgtcggcaaacgaacagatcgcg
tgcgctgcctgtcaccgccaggaattggggttcagcgatggacgggttgtttcgaacggc
gccacaggcgcactgctgcggcggaatacgccagggttgttcaatagcggcgaactcctg
gcgtttacctgggcgaatgttgaggtgcgaacgctggaacagcaggtggagcgcgcgctt
tttaccgttgacccgcctgagatgtgggtgagagggtatgagaccacggtgatcgaccgc
ctgcgcgccgatccagaatatctgcgtcaattcactgctgcgtttcccgcagatgacgac
ccgttcacctggcgacgcatcaccggggcgctggcagcctttgttcgctcgctggctgcg
cgcaacacgccatacgaccgatacgtctatgctggcgaccgtgcggcattgagcgacagt
gcgcaacgaggcatggcgctcttcttttcgccagggctggcgtgcggtcattgtcatgtt
gatgttccgtcgccggagcgcgccacgccgccacgctggtccgatctggcatatgtggcg
acgggcgccgggtacagcgcagatcgcggtctagcggagcagaccggcaatccggcggat
gcctaccgatttcgcgtgccgccgttgcggaatgtggcggtgactgcaccctatatgcac
gacggaagcctgcctaccctcgaggcggtcatccgattttatgagtccggcgggcgatgg
ggcgccggcgtggaaccggaacgcgtcgccgcccgtcacccgctgatcgccggttttgcg
ctgagcgacgaggagcgtcgcgatctgatagcctttctcgaagcgctgaccgacgatgaa
gcgttgcggaacccggcatttgccgacccgttcttatccgatgcgcgaaccccgtctgtt
cgctcgctctcccggtaa

DBGET integrated database retrieval system