KEGG   Roseiflexus castenholzii: Rcas_0558Help
Entry
Rcas_0558         CDS       T00585                                 

Definition
formyl-CoA transferase (EC:2.8.3.16)
Orthology
K07749  
formyl-CoA transferase [EC:2.8.3.16]
Organism
rca  Roseiflexus castenholzii
Brite
Enzymes [BR:rca01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.16  formyl-CoA transferase
     Rcas_0558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(743735..744925)
Genome map
AA seq 396 aa AA seqDB search
MTLPLEGLRVLDLSRALAGPFCSMMLGDLGADIIKVEQPGIGDHTRAWGPPFEGGESTYF
LSVNRNKRSLALDFRNERGAAVLRRLIASSDVLLENFVPGTLDRRGFGYEACRAIRPDLV
YCSISGFGQTGPDRERAAYDQIAQGLGGLMSLIGEPGGPPMRVGIAITDIMAGMFAAYAI
LAALYHRARTGEGQWVDTSLLEGQLAMLTYQAGNYFATGRAPDRPGNQHPSIVPYGVYRA
ADGYFTLGVGTDDLWERFCDALELTALRNDPRFRTNVSRLAHRAELNALLEPVFASLRVA
DVERHLNAAGVPCGAVRDLAQVFTDPQVQALGSVVTIDHPTAGSIRVVAPPYHFSATPPA
IRRSPPLLGQHTDEILAEIGYEPHEIATLRSAGVVA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgccgctcgaaggattgcgcgtcctcgatctgagccgcgcgcttgccggaccc
ttctgctcgatgatgctcggcgatctcggcgccgacatcatcaaggtcgaacagccgggc
attggcgaccacacccgcgcatggggaccaccgttcgaaggcggtgaaagtacgtatttt
ctcagcgtcaatcgcaacaagcgcagcctggcgctcgatttccgcaacgaacgcggcgct
gccgtgctgcgccgactgatcgccagcagtgatgtgctgctggaaaacttcgttcccggt
acgctggatcggcgcggattcgggtatgaagcgtgccgcgccatccgtcctgatctggtg
tattgctccatctccgggtttggtcagacgggaccggatcgtgagcgtgctgcctatgat
cagattgctcaggggttgggcgggttgatgagcctgatcggcgaacccggtggaccgcca
atgcgcgtcggcattgcgattaccgacatcatggcgggcatgttcgcggcatatgcaatc
ctggcggcgctctaccatcgcgcccgcacgggcgaagggcagtgggtcgatacctctctg
ctggaagggcaactggcgatgctgacctatcaggcgggcaactatttcgccaccggtcgc
gcgccggaccgaccgggcaaccagcatccttcgattgtgccgtatggagtctatcgcgct
gccgatggctactttacgctcggcgtcggcaccgatgatctgtgggagcgtttctgcgat
gcgctcgagttgacggcacttcgcaacgatccacgcttccgcacgaatgtgtcgcgcctg
gcgcatcgcgccgaactgaacgcgctcctcgagccggtgtttgcatcgctgcgcgttgcc
gacgtcgaacgacacctaaatgcggctggtgtgccctgcggcgctgtgcgcgatctggcg
caggttttcaccgatccgcaggtgcaggcgctaggaagcgtcgtgaccatcgatcatccg
actgcgggcagcatccgggtcgttgcgccgccgtaccatttctctgccacgccacccgcc
atccgccgctcaccaccgcttctagggcagcatactgatgagattctggctgaaatcggt
tatgaaccgcacgagattgcgacgctccggtctgctggcgttgtcgcatag

DBGET integrated database retrieval system