KEGG   Roseiflexus castenholzii: Rcas_0991Help
Entry
Rcas_0991         CDS       T00585                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rca  Roseiflexus castenholzii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rcas_0991 (tpiA)
   01230 Biosynthesis of amino acids
    Rcas_0991 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rcas_0991 (tpiA)
   00051 Fructose and mannose metabolism
    Rcas_0991 (tpiA)
   00562 Inositol phosphate metabolism
    Rcas_0991 (tpiA)
Enzymes [BR:rca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rcas_0991 (tpiA)
Exosome [BR:rca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rcas_0991 (tpiA)
  Exosomal proteins of bladder cancer cells
   Rcas_0991 (tpiA)
  Exosomal proteins of melanoma cells
   Rcas_0991 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1293558..1294322
Genome map
AA seq 254 aa AA seqDB search
MRTPLLAGNWKMYKTTGEARELVEGLLHGLGDVGDRKVLVCPPFTALQTVHDLVQGTPIA
LGAQDVYIEPQGAFTGAISPVMLRDLGCAYVIVGHSERRAIFGEGDELIGKKVRAALAHD
LTPILCVGETKPQRDAGHAETVVVAQVRAALTGMTPEQIGRIVIAYEPVWAIGTGDTATP
ADAQAMHETIRRILGDMAGSDTAATINILYGGSVKPDNIDDLMAQPDIDGALVGGASLKA
DSFLRIVHFLSPQE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacgccacttctcgcaggcaactggaagatgtacaaaaccaccggtgaggcgcgc
gaactcgtcgaagggctgctccacgggcttggcgacgtcggtgaccgcaaggtgctggtc
tgcccgccattcacggcgctgcaaacggtgcatgatctggtgcagggtacacccatcgca
ttgggagcacaggatgtctacatcgagccgcagggggcgtttaccggcgccatttctccg
gtgatgctgcgcgacctggggtgcgcctatgtgattgtcggacatagtgaacgccgcgcc
attttcggcgaaggggacgaattgatcggcaagaaggtgcgcgcggcgctggcgcacgat
ctcacgccgatcctgtgcgtcggcgagaccaagccacaacgcgacgccgggcatgcggaa
actgtcgtcgttgcgcaggtgcgcgccgcgctcaccggcatgacgccggagcagatcggt
cgcattgtcatcgcatatgagccggtgtgggcaatcggcaccggcgataccgccactccg
gccgacgcgcaggcaatgcacgaaacgatccggcggatccttggcgatatggcgggttcc
gacacggcggcgacgatcaatattctgtacggcggcagtgtcaaaccggacaatatcgac
gatctgatggcacaacccgacatcgacggggcgctggttgggggcgcatcgctcaaggcg
gacagtttcctgcgcattgtccatttcctttcaccgcaggagtaa

DBGET integrated database retrieval system