KEGG   Roseiflexus castenholzii: Rcas_0991Help
Entry
Rcas_0991         CDS       T00585                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00010  Glycolysis / Gluconeogenesis
rca00051  Fructose and mannose metabolism
rca00562  Inositol phosphate metabolism
rca01100  Metabolic pathways
rca01110  Biosynthesis of secondary metabolites
rca01120  Microbial metabolism in diverse environments
rca01130  Biosynthesis of antibiotics
rca01200  Carbon metabolism
rca01230  Biosynthesis of amino acids
Module
rca_M00002  Glycolysis, core module involving three-carbon compounds
rca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rcas_0991
   00051 Fructose and mannose metabolism
    Rcas_0991
   00562 Inositol phosphate metabolism
    Rcas_0991
Enzymes [BR:rca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rcas_0991
Exosome [BR:rca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rcas_0991
  Exosomal proteins of bladder cancer cells
   Rcas_0991
  Exosomal proteins of melanoma cells
   Rcas_0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABU57100
JGI: Rcas0991
UniProt: A7NI03
Position
1293558..1294322
Genome map
AA seq 254 aa AA seqDB search
MRTPLLAGNWKMYKTTGEARELVEGLLHGLGDVGDRKVLVCPPFTALQTVHDLVQGTPIA
LGAQDVYIEPQGAFTGAISPVMLRDLGCAYVIVGHSERRAIFGEGDELIGKKVRAALAHD
LTPILCVGETKPQRDAGHAETVVVAQVRAALTGMTPEQIGRIVIAYEPVWAIGTGDTATP
ADAQAMHETIRRILGDMAGSDTAATINILYGGSVKPDNIDDLMAQPDIDGALVGGASLKA
DSFLRIVHFLSPQE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacgccacttctcgcaggcaactggaagatgtacaaaaccaccggtgaggcgcgc
gaactcgtcgaagggctgctccacgggcttggcgacgtcggtgaccgcaaggtgctggtc
tgcccgccattcacggcgctgcaaacggtgcatgatctggtgcagggtacacccatcgca
ttgggagcacaggatgtctacatcgagccgcagggggcgtttaccggcgccatttctccg
gtgatgctgcgcgacctggggtgcgcctatgtgattgtcggacatagtgaacgccgcgcc
attttcggcgaaggggacgaattgatcggcaagaaggtgcgcgcggcgctggcgcacgat
ctcacgccgatcctgtgcgtcggcgagaccaagccacaacgcgacgccgggcatgcggaa
actgtcgtcgttgcgcaggtgcgcgccgcgctcaccggcatgacgccggagcagatcggt
cgcattgtcatcgcatatgagccggtgtgggcaatcggcaccggcgataccgccactccg
gccgacgcgcaggcaatgcacgaaacgatccggcggatccttggcgatatggcgggttcc
gacacggcggcgacgatcaatattctgtacggcggcagtgtcaaaccggacaatatcgac
gatctgatggcacaacccgacatcgacggggcgctggttgggggcgcatcgctcaaggcg
gacagtttcctgcgcattgtccatttcctttcaccgcaggagtaa

DBGET integrated database retrieval system