KEGG   Roseiflexus castenholzii: Rcas_1112Help
Entry
Rcas_1112         CDS       T00585                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rca  Roseiflexus castenholzii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rcas_1112 (ruvA)
Enzymes [BR:rca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Rcas_1112 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1440473..1441066
Genome map
AA seq 197 aa AA seqDB search
MIASVRGTLIAVAADHVVIETGGIGWMIYAPRQVLAAPGDIGAEMRLFTCLIVREDALTL
YGFKTVEQRQLFETLLSVTGVGPQAALNLLSSGTTDELRLAIATGDVARLARTPRIGKKL
AERLVLELKGKLDIKGLPVAPGVSPAVAAVNAELSEMLVSLGFSSAEASTAIAALPPDAP
LDLEERLRLALRYFGAR
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttcggtgcgaggaaccctgatagcagtcgctgccgatcacgtcgtgatcgaa
accggcggcatcggctggatgatctatgcgccgcgccaggtgctcgctgcgcctggtgac
atcggcgctgagatgcgcctgttcacctgtctgatcgtgcgcgaagacgcactcactctc
tatggcttcaagacggtcgaacagcggcagttgttcgagacgctcctcagtgtgacgggc
gttggtccgcaggcggcgttgaatctgctctcatcgggaacaaccgatgaactgcgattg
gcgattgccaccggcgatgtggcgcggctggcgcgcacgccgcgcatcggcaagaaactg
gcggaacgattggtgctggaactcaaaggtaaactcgatatcaaaggattgcctgttgcg
ccaggcgtctccccggcagtcgccgcagtgaacgctgaactatccgagatgctcgtcagc
ctggggtttagcagcgccgaggcgtccacggcaatcgcggcgcttccgcccgacgccccg
ctcgaccttgaagaacgcctgcggctggcgctgcgttatttcggcgcccggtaa

DBGET integrated database retrieval system