KEGG   Roseiflexus castenholzii DSM13941: Rcas_1461Help
Entry
Rcas_1461         CDS       T00585                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rca  Roseiflexus castenholzii DSM13941
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rca01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rca00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1863351..1864250
Genome map
AA seq 299 aa AA seqDB search
MRDVAIIGVPLDLGAGRRGVDMGPSAIRYAGLRERIVALGCQVRDLGNISVPLAEQIEPP
TPDERLRYLQPIAHAVRDLAQRVRDVVASGALPLMLGGDHSLSIGSVAGVAHNRRIGVIW
LDAHGDYNTPETTPSGNIHGMGLAALTGRGHPLLTDVLGQMPAVHPADVALVGVRSLDDG
ERDALRASGVRVFTMHDIDRRGMASVMEEAILHVSVNTAGFHLSFDLDALDPNEAPGVGT
PVLGGMTYREAHLAMELVAASGRLIGLDLVEVNPILDERNTTALLAVEFALSALGKRIY
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatgtcgccatcattggcgtgccgctcgaccttggcgccggtcggcgcggcgtt
gatatgggtccgagtgcaatccggtatgctgggctgcgcgagcggattgtggcgctcggt
tgtcaggtgcgcgatcttggcaatatcagcgttccgctggcggaacagatcgaaccgcca
acgccggatgaacggctgcgctacctccaacccatcgcgcatgccgtccgcgacctggcg
cagcgcgtgcgcgacgtcgtcgcatccggcgctctgccgctcatgctcggcggcgaccac
agtttgtcgattgggtcggtggcaggtgtggcgcacaaccgacgcattggcgtgatctgg
ctcgatgcgcatggcgactataatacaccagagacgacgccctcggggaatattcatggc
atggggcttgcggcgcttaccgggcgcgggcatcctctgctgaccgatgtgctcggacag
atgccggcggtgcatccggcggatgtggcgctggtgggtgtgcggagccttgatgacggc
gaacgggacgcgctccgcgcatccggggtgcgcgtctttacgatgcacgacatcgaccga
cgcgggatggcgtcggtgatggaagaggcgatcctgcacgtcagcgtcaatacggctgga
tttcacctgagttttgatctcgatgccctcgatccgaacgaagcgccaggggtcgggacg
ccggtgctcgggggcatgacgtatcgtgaggcgcatctggcgatggaactggtggcggcg
tccgggcgtttgatcgggcttgatctggtggaagtcaaccctattcttgacgagcgcaac
acgacggcgcttctggcggtcgagtttgcgctctcggcgctggggaaacggatttattga

DBGET integrated database retrieval system