KEGG   Roseiflexus castenholzii DSM13941: Rcas_1531Help
Entry
Rcas_1531         CDS       T00585                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rca  Roseiflexus castenholzii DSM13941
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rca01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rca00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:rca00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1950355..1951554)
Genome map
AA seq 399 aa AA seqDB search
MAVEIKVPTLGESIVEATVGAWRKHEGDPITAGEVLVELETDKVTVEVTAEESGVLSHIL
KPDGAIVTMGEILGIIAETAETPVAAQSHDGASGTRVMATPVARRVAETQGVDIAAIPGS
GPGGRVTKEDVLKRERAPRPAPMEHTPPPPAPTSAPPPVPAPVSGEGRREERIRMSRRRQ
TIAARLVEAQRTAAMLTTFNEIDMSAVIDLRKRHRDPFRERHGVGLGFMSFFTKAVIGAL
KAFPLLNAEIRGDEIIIKHYYDIGIAVSTDEGLVVPVLRDANRLSFAEIERGIEELARRA
RESKLTIADLQGGTFTITNGGIFGSLMSTPILNTPQVGILGMHKIQERPVALDGQVVIRP
MMYVALSYDHRIIDGREAVSFLVRVKELVEDPERLLLEG
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgagattaaggtcccaacactgggagagtcgatcgtcgaagccacggttggg
gcatggcgcaaacacgaaggcgacccgatcaccgccggtgaggtgctggtcgaactcgaa
accgataaagtaaccgttgaggtgaccgccgaagagtctggggttctgagccacattctc
aaacctgatggcgcgattgtgaccatgggcgaaatcctgggcattatcgctgaaaccgct
gagacgccggtcgcggcgcagtcgcacgatggcgcatccggaaccagagtgatggctact
ccggtcgcgcgccgggtcgccgagacgcagggggtggacattgccgccatccccggcagc
ggtcccggcggtcgggtgacgaaagaggacgtgctcaaacgcgagagggcgccccgtcct
gcgccgatggaacacacccccccgccgcccgctccgacatcggcgcctccgcctgttcct
gcgccggtctccggcgaaggacggcgtgaggagcgcattcggatgagtcgccgccgccag
acgattgccgcccgtcttgttgaagcgcaacgcacagcggcaatgctgacgacattcaac
gagatcgatatgagcgccgtcatcgacctgcgcaagcgccatcgcgatccgtttcgcgag
cgtcatggcgtcggtctcggtttcatgtcgttcttcacgaaagcagtcatcggcgcgctg
aaagccttcccgttgctcaatgccgaaatccgtggcgacgagatcatcatcaaacactat
tacgacatcggtattgccgtcagcaccgacgaagggttagtcgtgccggtgttgcgcgac
gccaatcgcctcagttttgccgagatcgagcgcggcatcgaagaactggcgcgccgcgcc
cgcgagtcaaaactcacgattgccgatctccagggaggcaccttcaccatcaccaacggc
ggtatcttcggctcactcatgtcaacgccaatcctcaacacaccgcaggttggcatcctg
ggcatgcacaagattcaggagcgcccggtagcgcttgatgggcaggtcgtcattcgcccg
atgatgtatgtcgcgctttcctacgatcaccgcattatcgacgggcgtgaggcggtatca
tttttggtgcgggtgaaagaactggtggaagacccagagcgactgttgctggaggggtaa

DBGET integrated database retrieval system