KEGG   Roseiflexus castenholzii: Rcas_1542Help
Entry
Rcas_1542         CDS       T00585                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
rca  Roseiflexus castenholzii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rcas_1542
Enzymes [BR:rca01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Rcas_1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1966051..1969902
Genome map
AA seq 1283 aa AA seqDB search
MRFVFLTMDGNHFAALREGAGLLHRDEGIALSLACYDTNALRTAADWQRLTDDVAASDFV
FGSMLFGEDFVRPLEPILAQATAPVCIITSNPALIRTTRLGRFDLRKKVEEQEASLLSRW
MHKFRPKNGRGEGQRQLALMRNLGRVLQHIPGKARDLATYVAVHQYWMHSSPENLRRMLV
MLIERYVPGYQGRLKVLPPIEYPDVALLHPDAPEPFADEREYEKWLAQRAKRRKNEPRQG
AVGLLTLRTVALSGNMAHLHALYRALEQRGLDVRMAYAAGLDFRPAIERFFLERESRMHW
FGSGNAGPHPRRARIDALVNGVGFALVGGMAASQPDEAVAALRDLDTRYLGFIPLSFQRV
EEWRRDDSGLTPIQVAMNVALPELDGAIDPLVFGGPTVDSDRFVPLPEQIELAAERIARH
VALRRTPPRTRKLAIVLFNFPPTLGNAGTAAYLDVFASVHRLLCALCDAGYTVEVPASPE
ELRHLVVQHNADLFGTPGSVAARLSINDYRRLFPAYTAIEPFWGAAPGELLTDGRDFFIC
GHVFGNVFVGLQPSFGYERDPMRLLMAKDAAPHHGFAAFYTWVAHVFGAHAVLHFGTHGA
LEFMPGKQSGLSAQCWPARLLGPLPNIYYYSVNNPSEGTIAKRRSAATLVSYMVPPLQQA
GLYKGLRRLKDSLDAYRARPQSGMLDDIRAQAEQLGIGSELVDIKNDEAYVAALAHELLQ
IEQRMIPVGLHVLDKEPNPAELTDVLALVAAFACPSGVEQPLTHLVAAAMGYDYGRLQAA
LGHDPQAQEVFQQIDALVRDAMRALVDEYRNRAFSSPVPGVTFEQTLLQRASVSVGVLRR
FRIYLEELLDRMMHDHELRNLLHALDGGYIPPSPGNDVVRNPAVVPTGRNIHGLDPYRVP
TAVAQATGERLVSDLLARLCREQGRMPESVAIVLWGTDNLKSDGEGIAQALALMGARPVA
DELGNISDVALIPLAELGRPRIDAVMTVSGIFRDLFSHQMQLLSKAARLAAHADEPPEWN
YVRKHALAHAVELGISLDEAATRVFSNAPGSYGANVNHLVESSTWNSDAEMSEAFVSRKS
FAPGAHGEWRDARAVLERALATVDATFQNVDSFEIGISDIDHYYEYLGGVTKSVEKLRGS
RPRVFVAEALATTGERISTLEQQVRIETRAKLLNPKWFEAMLAHGYQGVHEIEARVGNTY
GWSATADAVEGWVYQGVAETFMLDETMRERLARLNPHAATAIAGRLLEAHSRGFWQADEA
TLDALQAIYADLEDRLEGVAVER
NT seq 3852 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcgtctttctgactatggacggtaaccattttgcggcgctacgcgagggcgcc
gggttgctgcaccgcgacgaggggattgcactgagtctagcgtgctacgacacaaatgcg
cttcgaactgccgccgattggcaacgcctgactgatgatgtggcggcgagcgattttgtg
tttggctccatgctcttcggtgaagactttgtccgtccgctggagccgattctggcgcag
gcgacggcgccggtctgcatcattacgagcaatccggcgctgatccgcacgacacgcctt
gggcgcttcgatctgcggaagaaggtggaggaacaggaagcgtcgctcctgagtcgctgg
atgcacaagttccgccccaaaaacgggcgtggcgaagggcaacggcaactggcgctcatg
cgtaatctggggcgcgttttgcaacacattcccggcaaggcgcgcgatctggcaacctat
gtcgctgtccatcagtactggatgcacagttcaccggagaatctgcggcgcatgctggtg
atgctgatcgaacggtacgttcccggttatcagggtcgcctgaaggtactgccgccaatc
gagtatcctgatgtggcgctattgcatcccgatgcgccagaaccgttcgccgacgaacgc
gagtacgagaagtggctggcgcagcgcgcgaaacgccgcaagaacgaaccacgccagggc
gctgtcggactgctgacgttgcgcacagtggcgttgagcggcaacatggcgcacctccac
gccctctatcgcgcgctggagcagcgtggtctcgacgtgcgcatggcatacgctgccggt
ctcgattttcgccctgcaatcgagcgtttcttcctggaacgcgagtcgcgtatgcactgg
ttcggcagcggcaatgccggaccgcatccccgacgggcaaggattgatgcgctggtcaat
ggcgtgggttttgcgctcgtcggcggcatggcggcgagccagcccgatgaggcggtcgcc
gcgctgcgcgacctcgatacccgctacctggggttcattccgctttcgtttcagcgtgtc
gaggagtggcgccgcgatgacagcgggttgactcccattcaggtggcgatgaatgtggcg
ctgcccgaactcgatggcgcgattgatccgctcgtgtttggcggaccgacggttgacagt
gatcgcttcgtgccgcttcccgaacagatcgaactggcagccgaacgcatcgcgcggcac
gtggcgctgcggcgtaccccgcctcgcaccaggaaactggcgattgtgctgttcaacttc
ccgccaacccttggcaatgccggcactgccgcctacctcgatgtctttgcctcggtgcat
cgcctgctctgcgccctgtgcgacgccgggtacacggtcgaggtcccggcgtcgccggaa
gaactgcgccacctggtggtgcagcacaatgccgatctcttcggcacgcccggcagcgtt
gctgcacgtctgagcatcaacgattaccggcgtctcttccctgcgtacactgccattgag
ccattctggggcgccgctccgggcgagttgctgaccgatggacgcgactttttcatctgt
ggtcacgtgttcggcaatgtattcgtcggattgcaaccctccttcgggtacgagcgcgac
ccgatgcgcttgctgatggcgaaggatgccgcgccgcaccacggctttgcagcgttctat
acctgggtggcgcacgtgttcggcgcgcatgcggtgctgcacttcggcacccacggcgcg
ctggagtttatgccagggaaacagtccggactcagcgcacagtgctggcccgcgcgattg
ctcggtccgttgccgaatatctactactacagcgtcaacaatccgagcgagggaacgatc
gccaaacggcgcagcgcggcgacgctggtgagttacatggttccgccgctgcaacaggca
gggttgtacaaagggctgcgccgcctgaaggattccctcgacgcctaccgcgcgcgtccg
cagtcgggtatgctggacgatattcgggcgcaggcggaacagttgggtattggcagtgag
ttggttgacataaaaaatgacgaggcgtatgtcgcggcgctggcgcacgaactgttgcag
atcgaacagcgcatgatcccggtcgggttgcacgtgctcgataaagaacccaatcccgcc
gaattgaccgacgtgctggcgctggttgcggcattcgcctgtccgtcaggcgtcgagcag
ccgctgacccatctggttgccgcagcaatgggatacgattacggtcggcttcaggcggcg
ttgggtcacgacccgcaggcacaggaggtctttcagcagatcgatgcgctggtgcgcgac
gccatgcgcgcgctggtggacgagtaccgcaatcgtgcgttttcttcgcctgtgcccgga
gtgacgtttgagcagacgctattgcagcgcgcatcggtttcggtcggcgtcttgcgccgg
ttccgcatctacctggaagaactgctcgaccgcatgatgcacgaccacgaactgcgcaat
ctgctgcacgcgctcgatggcggctacatcccgccgtcgccgggcaacgatgtggtgcgc
aacccggcggttgttccgaccggacgcaacattcatggtctcgatccctaccgcgttcca
accgccgttgcgcaggcgaccggcgaacgcctggtgtccgatcttctggcgcgcctgtgc
cgcgagcagggtcgcatgccggagagtgtcgccatcgtgctgtgggggacggataacctg
aagagcgacggcgaaggcattgcgcaggcgctggcgctcatgggcgcgcgtccggtcgct
gatgaactcggcaacatcagcgacgtggcgctcattccgctggcggaacttggcagaccg
cgcatcgacgcagtgatgaccgtcagcggcatcttccgcgatctgttcagccatcagatg
cagttgttgagtaaagccgcacggctggcggcgcacgccgatgagccgccggagtggaac
tatgtgcgcaaacacgcactggcgcatgctgtcgaactgggcatcagcctcgacgaagcc
gccacgcgcgtcttctcgaatgcgccgggcagctacggtgcgaatgtcaaccatctggtc
gaaagcagcacatggaacagcgacgcggaaatgagcgaagcctttgtgtcgcggaagagt
ttcgcccccggcgcgcatggcgaatggcgtgacgcgcgcgctgtgttggagcgggcgctg
gcgacggtcgatgcaaccttccagaatgtcgatagtttcgagatcgggatcagcgacatc
gaccactactacgaatacctcggcggtgtgacgaagagtgtcgagaaactgcgtggcagc
cgaccgcgcgtatttgtcgccgaggcgctggcaacgaccggtgagcgcatcagcaccctg
gagcagcaggtgcgcatcgagacccgcgccaaactgttgaatccaaaatggttcgaggcg
atgctggcgcatggctatcagggagtgcacgagatcgaagcgcgcgttggcaacacctat
ggctggagcgccacggcagatgccgtcgaagggtgggtgtatcagggagttgccgaaaca
ttcatgctcgacgaaacgatgcgcgagcgtctggcgcgcctcaacccccatgccgccact
gccatcgccggcaggttgctcgaagcgcacagccgtggcttctggcaggcggacgaagcg
acgctcgatgcgttgcaagcgatttatgcggaccttgaggatcgactggaaggagtcgcc
gtcgaacgttga

DBGET integrated database retrieval system