KEGG   Roseiflexus castenholzii: Rcas_1544Help
Entry
Rcas_1544         CDS       T00585                                 

Definition
magnesium chelatase ATPase subunit I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rca  Roseiflexus castenholzii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rcas_1544
Enzymes [BR:rca01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Rcas_1544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1971248..1972381
Genome map
AA seq 377 aa AA seqDB search
MTTTSVETQNGKTTDSGVTTLPVYPFTAIVGQAELKLALLLCVIDPTIGGVMVMGHRGTA
KSTAVRALAALLPPQRAVAGCPYGCDPAAPSSICPHCAAPDQDAAKNGQEKRRASAKRPP
SVLRPVPVVDLPLGATEDRVVGALDIERALVEGVQTFAPGLLARANRGFLYIDEVNLLED
HLVDLLLDVAQSGVNVVEREGISVRHPARFVLVGSGNPEEGDLRPQLLDRFGLHARITTI
DDVAERVEIVKRRRAFDADPVAFAQQWEREQQRLQRRIRMAQKRLPSVELTDEALYAAAR
LCVALNIDGHRGELTLARAAVALAAFEGRESAQPSDIARVATLSLRHRLRKDPLETSGDD
ARIERAVAETIGAAARA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacctctgttgaaactcagaatggcaagacgaccgacagcggcgtcacaacg
ctgccggtctatccatttactgcgattgtcggtcaggcagaactgaaactcgcgttgctt
ctctgtgtgatcgatccaacgattggcggcgtgatggttatgggacatcgcggaacggcg
aagagcacggcggtgcgagcactggcagcgttgctcccgccgcagcgcgccgttgccggg
tgcccctacggttgcgatcccgccgcgccgtcgtcgatctgtccacactgcgctgcaccc
gaccaggacgccgcgaagaacgggcaggagaaacggcgcgccagcgcaaaacgcccgcca
tcggttctgcgcccggtaccggtggtcgatctgccgctcggcgctaccgaagatcgggta
gtcggcgcgctcgacattgagcgcgcattggtcgaaggagtgcagacatttgcgccaggg
ttgctggcgcgcgccaatcgtggctttctctacatcgacgaagtgaacctgctcgaagat
catctggtcgatctgctgctcgacgtcgcgcagagcggcgtcaacgtcgttgagcgcgag
ggcatctcggtgcgtcatccggcgcgattcgtgctcgtgggcagcggcaaccccgaagaa
ggcgacctgcgcccacagttgctcgaccggtttgggctgcatgcgcgcatcaccacgatc
gacgatgtggcagagcgcgtcgagatcgtcaaacgtcgacgcgccttcgatgccgacccg
gtagcctttgcgcagcagtgggagcgggagcagcaacggttgcagcgccgcatccgcatg
gcgcagaagcgtcttccctcggttgagttgaccgacgaggcattgtatgctgcggcgcgg
ttgtgtgtggcgttgaatatcgacgggcaccgtggcgaactgacactggcgcgtgctgcg
gtggcgcttgccgcgttcgaggggcgcgagagcgcacagccgtccgacattgcgcgggtt
gcgacgctgtcgctgcggcaccgattgcgcaaagacccgctcgaaacatccggcgacgat
gcgcggatcgaacgcgccgttgctgaaacgatcggcgccgcagcgcgcgcgtga

DBGET integrated database retrieval system