KEGG   Roseiflexus castenholzii: Rcas_1550Help
Entry
Rcas_1550         CDS       T00585                                 

Definition
(GenBank) branched-chain amino acid aminotransferase
  KO
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
rca  Roseiflexus castenholzii
Pathway
Cysteine and methionine metabolism
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Rcas_1550
   01230 Biosynthesis of amino acids
    Rcas_1550
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rcas_1550
   00280 Valine, leucine and isoleucine degradation
    Rcas_1550
   00290 Valine, leucine and isoleucine biosynthesis
    Rcas_1550
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rcas_1550
Enzymes [BR:rca01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     Rcas_1550
Amino acid related enzymes [BR:rca01007]
 Aminotransferase (transaminase)
  Class IV
   Rcas_1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1989930..1990859)
Genome map
AA seq 309 aa AA seqDB search
MPIRESKYIWFNGEMVAWEKATVHVMTHALHYGSSVFEGIRAYETPQGAAIFRLREHLRR
LFDSCRIYRMELPFTPEQLFEACRAVVRDNGLTNAYIRPLVWRGYGEMGLNPLRSPVEVM
VAAMEWGAYLGAEGLENGVDVHVSSWQRVAPNTLPAMAKAGGNYLSSQLIVMEAARNGYA
EGIALDVHGWLSEGSGENLFLIRDGVIYTPPVTAALLPGITRDAVITLARQMGYEVREQN
LPREMLYLADELFFTGTAAEVTPIRSVDKLPVGNGKRGPITTAIQKAFFGLFSGETEDRW
GWLTPVAYS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcctattcgtgagtccaagtatatctggttcaacggcgagatggttgcctgggaaaag
gcgaccgtccatgtgatgacacatgccctgcactacggttcatcggtgttcgagggcatt
cgcgcctacgaaacgcctcagggcgctgctatttttcgtttgcgcgagcacctccgccgt
ctgttcgactcgtgccgcatctatcggatggaactgccgttcacgccggagcaattgttc
gaagcatgccgcgcggtcgtgcgtgacaatgggttgacgaacgcctatatccgtccgctt
gtgtggcgcggctatggcgaaatggggctaaacccgctgcgctcgccggtcgaggtgatg
gtcgcagccatggaatggggcgcctacctgggggctgagggtttggagaatggcgtggat
gtccacgtttcctcctggcagcgggttgcaccgaataccctgccagcgatggcgaaggct
ggcggcaactatctgtcgtcacaactcattgtgatggaagcggcacgcaacggctatgcc
gaaggcatcgcgctcgatgtgcatggctggctctccgaaggatcgggcgaaaacctgttc
ctcattcgcgacggcgtcatctatacgccgccggtgacggcggcgcttctgcccggcatt
acccgcgatgcagtgatcacactggcgcgccagatggggtatgaggtgcgcgagcaaaac
ctgccgcgcgaaatgctctacctggcggacgaactcttctttaccggcacagcggctgag
gtgacgccgatccgctcggtcgataaattgccggtcggcaatggcaagcgcggtccgatc
accaccgctatccaaaaggcgttctttggtcttttctccggcgaaacagaagatcgctgg
ggctggctgacgccagtggcgtattcgtag

DBGET integrated database retrieval system