KEGG   Roseiflexus castenholzii DSM13941: Rcas_1550Help
Entry
Rcas_1550         CDS       T00585                                 

Definition
branched-chain amino acid aminotransferase
Orthology
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
rca  Roseiflexus castenholzii DSM13941
Pathway
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:rca01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rca01230]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:rca00280]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:rca00290]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:rca00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1989930..1990859)
Genome map
AA seq 309 aa AA seqDB search
MPIRESKYIWFNGEMVAWEKATVHVMTHALHYGSSVFEGIRAYETPQGAAIFRLREHLRR
LFDSCRIYRMELPFTPEQLFEACRAVVRDNGLTNAYIRPLVWRGYGEMGLNPLRSPVEVM
VAAMEWGAYLGAEGLENGVDVHVSSWQRVAPNTLPAMAKAGGNYLSSQLIVMEAARNGYA
EGIALDVHGWLSEGSGENLFLIRDGVIYTPPVTAALLPGITRDAVITLARQMGYEVREQN
LPREMLYLADELFFTGTAAEVTPIRSVDKLPVGNGKRGPITTAIQKAFFGLFSGETEDRW
GWLTPVAYS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcctattcgtgagtccaagtatatctggttcaacggcgagatggttgcctgggaaaag
gcgaccgtccatgtgatgacacatgccctgcactacggttcatcggtgttcgagggcatt
cgcgcctacgaaacgcctcagggcgctgctatttttcgtttgcgcgagcacctccgccgt
ctgttcgactcgtgccgcatctatcggatggaactgccgttcacgccggagcaattgttc
gaagcatgccgcgcggtcgtgcgtgacaatgggttgacgaacgcctatatccgtccgctt
gtgtggcgcggctatggcgaaatggggctaaacccgctgcgctcgccggtcgaggtgatg
gtcgcagccatggaatggggcgcctacctgggggctgagggtttggagaatggcgtggat
gtccacgtttcctcctggcagcgggttgcaccgaataccctgccagcgatggcgaaggct
ggcggcaactatctgtcgtcacaactcattgtgatggaagcggcacgcaacggctatgcc
gaaggcatcgcgctcgatgtgcatggctggctctccgaaggatcgggcgaaaacctgttc
ctcattcgcgacggcgtcatctatacgccgccggtgacggcggcgcttctgcccggcatt
acccgcgatgcagtgatcacactggcgcgccagatggggtatgaggtgcgcgagcaaaac
ctgccgcgcgaaatgctctacctggcggacgaactcttctttaccggcacagcggctgag
gtgacgccgatccgctcggtcgataaattgccggtcggcaatggcaagcgcggtccgatc
accaccgctatccaaaaggcgttctttggtcttttctccggcgaaacagaagatcgctgg
ggctggctgacgccagtggcgtattcgtag

DBGET integrated database retrieval system