KEGG   Roseiflexus castenholzii: Rcas_1550Help
Entry
Rcas_1550         CDS       T00585                                 

Definition
branched-chain amino acid aminotransferase
Orthology
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
rca  Roseiflexus castenholzii
Pathway
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Rcas_1550
   01230 Biosynthesis of amino acids
    Rcas_1550
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rcas_1550
   00290 Valine, leucine and isoleucine biosynthesis
    Rcas_1550
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rcas_1550
Enzymes [BR:rca01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     Rcas_1550
Amino acid related enzymes [BR:rca01007]
 Aminotransferase (transaminase)
  Class IV
   Rcas_1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1989930..1990859)
Genome map
AA seq 309 aa AA seqDB search
MPIRESKYIWFNGEMVAWEKATVHVMTHALHYGSSVFEGIRAYETPQGAAIFRLREHLRR
LFDSCRIYRMELPFTPEQLFEACRAVVRDNGLTNAYIRPLVWRGYGEMGLNPLRSPVEVM
VAAMEWGAYLGAEGLENGVDVHVSSWQRVAPNTLPAMAKAGGNYLSSQLIVMEAARNGYA
EGIALDVHGWLSEGSGENLFLIRDGVIYTPPVTAALLPGITRDAVITLARQMGYEVREQN
LPREMLYLADELFFTGTAAEVTPIRSVDKLPVGNGKRGPITTAIQKAFFGLFSGETEDRW
GWLTPVAYS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcctattcgtgagtccaagtatatctggttcaacggcgagatggttgcctgggaaaag
gcgaccgtccatgtgatgacacatgccctgcactacggttcatcggtgttcgagggcatt
cgcgcctacgaaacgcctcagggcgctgctatttttcgtttgcgcgagcacctccgccgt
ctgttcgactcgtgccgcatctatcggatggaactgccgttcacgccggagcaattgttc
gaagcatgccgcgcggtcgtgcgtgacaatgggttgacgaacgcctatatccgtccgctt
gtgtggcgcggctatggcgaaatggggctaaacccgctgcgctcgccggtcgaggtgatg
gtcgcagccatggaatggggcgcctacctgggggctgagggtttggagaatggcgtggat
gtccacgtttcctcctggcagcgggttgcaccgaataccctgccagcgatggcgaaggct
ggcggcaactatctgtcgtcacaactcattgtgatggaagcggcacgcaacggctatgcc
gaaggcatcgcgctcgatgtgcatggctggctctccgaaggatcgggcgaaaacctgttc
ctcattcgcgacggcgtcatctatacgccgccggtgacggcggcgcttctgcccggcatt
acccgcgatgcagtgatcacactggcgcgccagatggggtatgaggtgcgcgagcaaaac
ctgccgcgcgaaatgctctacctggcggacgaactcttctttaccggcacagcggctgag
gtgacgccgatccgctcggtcgataaattgccggtcggcaatggcaagcgcggtccgatc
accaccgctatccaaaaggcgttctttggtcttttctccggcgaaacagaagatcgctgg
ggctggctgacgccagtggcgtattcgtag

DBGET integrated database retrieval system