KEGG   Roseiflexus castenholzii DSM13941: Rcas_1875Help
Entry
Rcas_1875         CDS       T00585                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rca  Roseiflexus castenholzii DSM13941
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:rca01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rca01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rca00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rca00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rca00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rca00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:rca00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2405487..2407721)
Genome map
AA seq 744 aa AA seqDB search
MTQPTGIGVLTSGGDAQGMNAALRAVVRTALSRGVPVYAIYEGYRGMVEGGNRIRPLSWD
DVGGIMHRGGTIIGTARSRTFRTREGRLQAAANLIEHGINRLVVIGGDGSLTGADTFRRE
WSSLLAELVETGKLSRETAARYPFLALVGLVGSIDNDFYGTDMTIGADSALHRITAAIDA
LVSTAASHQRTFVVEVMGRHCGYLALMGAVAGGADYVLIPENPPEPGWEDRMCALLRAGR
AAGRRESIVVVAEGARDREGNPITSDYVRRVLEERLEEDARVTILGHVQRGGTPSAFDRW
MSTLVGYAAVEELLSATPDSEPQLIGMRYNRITRQPLMHCVEQTQQVSAAIAAGDYQRAM
ELRGGSFTEMFQTFQALASALPSVTRPRRRRIALLHAGGPAPGMNTAVRAAVRLGLDQGH
TMLVVRNGFDGLIAGHVSECEWQMVDGWGPMGGAELGTSRRVPSGDDLAAVAHALTRHSI
DGLLIIGGWNGYQAAHRLYHERDAHEPFNIPIICLPASINNDLPGSELSIGADTALNAIV
EALDRIKQSAVAVRRTFVVEVMGRYCGYLALMSGLASGAERVYLHEEGITLDDLRADIQE
MIKGFRAGKRLSLVIRNEYANRLYTTDVICALFEEEGKGLFDVRRAVLGHLQQGGSPSPY
DRIQATRLAARCIRFLTEEMERGTAAAAFIGFINGRVRIFDLGELPHMVDAVYRRPREQW
WLQLAPIARALAQQKHDMHDMREL
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagccaacaggcattggcgtgctgaccagcggtggcgacgcgcagggcatgaac
gccgcgctgcgtgccgtggtgcgcaccgcgctgagtcgtggcgtgccagtgtatgcgatt
tatgaaggataccgtggcatggtagaaggcggcaaccgcatccgtccgctcagttgggac
gatgtcggcggcattatgcatcgcggcggaacgatcatcggcacagcacgcagtcgcacg
ttccgcacgcgcgaagggcgtttgcaggctgccgccaatctgatcgagcacgggatcaat
cgcctggtggtcatcggcggcgatggaagtctgaccggcgccgacacattccgccgcgag
tggagcagcctgctggcggaactggtcgaaaccggcaaactgtcgcgtgaaacggcggcg
cgctatccgttcctggcgctggtcgggctggttggttcaatcgacaacgatttctacggc
accgacatgaccatcggcgcggactcggcattgcaccggattactgccgcgattgatgcg
ctcgtcagcaccgcagccagtcatcagcgcacgtttgttgtggaggtgatggggcgccac
tgcgggtatctggcgctgatgggcgctgtggctggcggcgccgactatgtgctcattcca
gagaatccgcctgagccggggtgggaggaccgcatgtgcgcactgctacgcgccgggcgc
gccgccgggcgccgcgagagcattgtcgtcgttgcggaaggcgcgcgcgaccgggaggga
aatccgatcacgtcggattatgtgcggcgcgtgctggaggagcgtctggaagaagacgca
cgcgtgaccatcctgggacacgtgcaacgcggcggcacaccgagcgccttcgaccgctgg
atgagcacgctcgtcgggtacgctgccgttgaagaattgttgagcgccacccccgacagc
gagccgcaactgatcgggatgcgctacaatcgtatcacgcgccaaccactcatgcactgt
gtcgagcagacacagcaggtaagtgcagcaatcgcggctggcgactatcagcgcgccatg
gaactgcgcggcggcagttttaccgagatgttccagacatttcaggcgctcgccagcgct
ctgccaagtgtgacgcgcccgcgcaggcgacgaatcgcactgctgcatgccggtggaccg
gcgccgggcatgaataccgccgtgcgcgccgccgtgcgcctcggtctcgaccagggacac
accatgctggttgtgcgcaatggcttcgacggtctcatcgccggccacgtcagcgagtgc
gaatggcagatggtggacggttggggaccaatggggggcgcagaactcggcaccagccgt
cgtgttccatccggcgatgaccttgccgccgttgcgcatgcattgaccaggcacagcatc
gacgggttgctgatcatcggcgggtggaacggctatcaggcggcgcaccgtttgtaccat
gagcgtgatgcgcacgaaccattcaatatcccaatcatctgcctgcctgcctcgatcaac
aatgatctgcccggttcggagttgagcatcggcgccgacacggcactgaatgcgatcgtc
gaagcgctcgaccggatcaagcaatcggcagtggcagtgcgacgcaccttcgtggttgag
gtcatggggcgctactgcggctacctggcgctgatgagcgggctggcgtcgggtgcggaa
cgggtgtacctgcatgaggagggcatcacccttgatgacttgcgcgccgatattcaggag
atgatcaaaggatttcgcgctggcaagcgtctcagtctggtgatacgcaatgagtacgcc
aaccgcctctatacgaccgatgtgatctgtgcgcttttcgaggaggaggggaaaggattg
ttcgacgttcgccgcgcagtcctcggtcatttgcaacagggtggaagcccatcgccgtat
gatcggattcaggcaacgcgcctcgcagcacgctgcatccgctttctgactgaggaaatg
gagcgcggcaccgcagccgcagcctttatcggtttcatcaacggtagagtgcgaatattc
gacctgggtgaactgccgcacatggtcgatgccgtataccgccgccccagagagcaatgg
tggcttcaactggcgccaattgcgcgcgcactcgcacaacagaagcacgacatgcacgac
atgagggaactatga

DBGET integrated database retrieval system