KEGG   Roseiflexus castenholzii DSM13941: Rcas_1884Help
Entry
Rcas_1884         CDS       T00585                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
rca  Roseiflexus castenholzii DSM13941
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rca00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rca00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:rca00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2418834..2420240
Genome map
AA seq 468 aa AA seqDB search
MPPKIVFIGAGSTVFAKNLMGDILSFPELANATLTLFDIDPERLRTSEVVAHKVAAALDA
RPTIEATTDRRRALDGADYAICMIQVGGYKPCTVTDFEIPKKYGLRQTIADTLGIGGIMR
GLRTIPVLLSICRDMEEVCPDVTFLQYVNPMAMNCWAISRASTIKTVGLCHSVQGTAEQL
AHDIGVPVEEINYVCAGINHMAFYLRFERNGEDLYPLIRKVYDEGRVPAWNRVRYEVFRR
LGYFVTESSEHFSEYVPWFIKRDRPDLIERFNIPLDEYIRRCEVQLAGWEFVQYKLDHPE
IASSDLRAAMRERSRTNPYLTGEFIDYVITSAEDLEAGKVERSHEYGSLIIHSLETGQPR
VVYGNVPNYGLIDNLPQGCCVEVPCLVDKNGVQPTKIGALPPHLAALMQTNINVQALTVE
AALTGKREHIYHAAMLDPHTAAELDLDQIWALVDDLIAAHGDWLPEYR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaaagattgtcttcatcggcgccggcagcacggtgttcgccaaaaacttgatg
ggcgacatcctgagcttccccgaacttgccaacgccacgctgacgttgttcgacattgac
ccggagcgcttgcgtacatccgaagtcgtggcgcacaaggtcgctgcggcgctcgacgcg
cgcccgacgattgaggcgacgaccgaccgacgccgcgcgctcgatggcgccgattatgcc
atttgcatgatccaggtcggcggttataagccgtgtacggtgaccgatttcgagatcccg
aagaagtatggtctgcgccagacgattgccgataccctgggcatcggcgggattatgcgc
gggttgcgcaccattccagtgttgctctcgatatgccgcgatatggaagaggtgtgtccc
gatgtgacgttcttgcagtatgtcaatccaatggccatgaattgctgggcgatcagtcgc
gccagcacgattaagacggtcgggttgtgccacagtgtgcagggcactgccgagcaactg
gcgcacgacattggcgtgccggtagaggagatcaactatgtctgcgctggcatcaaccat
atggcgttctacctgcgcttcgagcgaaacggcgaagacctctatccgctcatccgcaag
gtctacgacgaagggcgcgtgccggcgtggaatcgggtgcgctacgaagtgttccgacgc
cttggctattttgtgaccgagtcgagcgagcacttcagtgaatacgtgccctggttcatc
aagcgcgaccgacccgatctgatcgagcgctttaatattccgctcgatgaatacatccgc
cgttgcgaagtgcaactggcgggctgggagttcgtgcagtacaaactcgatcatccagag
attgcgagttccgatctgcgcgctgcgatgcgcgaacgttcccgcaccaatccgtacctg
acgggcgagttcatcgactatgtcatcacatctgccgaagacctcgaggcagggaaggtc
gagcgcagccacgagtatggctcgctgatcatccacagcctggaaacggggcaaccgcgc
gtggtctacggaaatgtgcctaactatgggctgatcgataatctcccacaggggtgctgc
gtcgaagttccgtgtctggtggacaaaaacggcgttcagccgacaaagatcggcgcactg
ccgccgcacctcgctgcgctcatgcaaacgaacatcaacgtgcaggcgttgaccgtcgaa
gcggcgctgaccggcaaacgcgagcatatctaccacgcggcgatgctcgatccgcacact
gccgctgaactcgatctggatcagatctgggcattggtggatgacttgatcgccgcccac
ggcgactggttgccggagtatcggtag

DBGET integrated database retrieval system