KEGG   Roseiflexus castenholzii: Rcas_1948Help
Entry
Rcas_1948         CDS       T00585                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rca  Roseiflexus castenholzii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rcas_1948
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rcas_1948
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rcas_1948
Enzymes [BR:rca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rcas_1948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2497155..2497940
Genome map
AA seq 261 aa AA seqDB search
MSRIADTFARLRAAGRTALMPYLMTGYPERDSVLDLAPALEDAGADLFELGVPFSDPLAD
GATIQRASERALANGVRLEHCIATIAVLRERGVRAPIVPMGYYNPFLQYGLARLARDMAA
AGADGLIIPDLPPEEAQECHAACREYGLDLIFFVAPTTPDERIARITALASGFIYCVSLT
GVTGARRELWSGLPAFLERVRRHTTLPLVVGFGISSADHVREVGRHAAGAIVASALINVI
EQSHPGEYVARAAEFVRLLRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcattgccgatacctttgcccgattgcgcgctgccggtcgcacagcgctgatg
ccttatctgatgaccggctatcccgagcgcgattcggtgctggaccttgcgccggcgctg
gaggatgccggcgccgatctgttcgagcttggcgtcccgttttccgatccgctcgccgat
ggcgcgacgattcaacgcgcttctgaacgcgcgcttgcgaatggtgttcgtctcgagcac
tgcattgcaaccattgccgtattgcgcgaacgtggcgtgcgcgcgccgattgtgccaatg
gggtattacaacccgtttttgcagtatggtctcgcgcgtctggcgcgcgatatggcagcc
gccggcgcggatgggttgattatccctgatttgccgccggaagaagcgcaggagtgtcac
gccgcctgccgcgaatatggtctcgatctgatcttcttcgtcgcacccacgacccctgat
gagcgcattgcccgcattactgcgctcgccagcggtttcatctattgcgtttcgctgacc
ggcgtcaccggcgcgcggcgcgaattgtggagcggactgcccgccttcctggaacgggtg
cggcgtcacaccaccctgccgctcgttgtcgggttcggcatcagcagcgccgatcatgtg
cgtgaggtcggcaggcatgcggcaggtgcgattgtcgccagtgcgctgatcaacgttatc
gaacagtcgcatcctggcgaatatgtcgcgcgcgcggctgagttcgtgcggttgttgcgc
ggctga

DBGET integrated database retrieval system