KEGG   Roseiflexus castenholzii: Rcas_1948Help
Entry
Rcas_1948         CDS       T00585                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00260  Glycine, serine and threonine metabolism
rca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rca01100  Metabolic pathways
rca01110  Biosynthesis of secondary metabolites
rca01130  Biosynthesis of antibiotics
rca01230  Biosynthesis of amino acids
Module
rca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rcas_1948
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rcas_1948
Enzymes [BR:rca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rcas_1948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABU58037
JGI: Rcas1948
UniProt: A7NKL7
Position
2497155..2497940
Genome map
AA seq 261 aa AA seqDB search
MSRIADTFARLRAAGRTALMPYLMTGYPERDSVLDLAPALEDAGADLFELGVPFSDPLAD
GATIQRASERALANGVRLEHCIATIAVLRERGVRAPIVPMGYYNPFLQYGLARLARDMAA
AGADGLIIPDLPPEEAQECHAACREYGLDLIFFVAPTTPDERIARITALASGFIYCVSLT
GVTGARRELWSGLPAFLERVRRHTTLPLVVGFGISSADHVREVGRHAAGAIVASALINVI
EQSHPGEYVARAAEFVRLLRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcattgccgatacctttgcccgattgcgcgctgccggtcgcacagcgctgatg
ccttatctgatgaccggctatcccgagcgcgattcggtgctggaccttgcgccggcgctg
gaggatgccggcgccgatctgttcgagcttggcgtcccgttttccgatccgctcgccgat
ggcgcgacgattcaacgcgcttctgaacgcgcgcttgcgaatggtgttcgtctcgagcac
tgcattgcaaccattgccgtattgcgcgaacgtggcgtgcgcgcgccgattgtgccaatg
gggtattacaacccgtttttgcagtatggtctcgcgcgtctggcgcgcgatatggcagcc
gccggcgcggatgggttgattatccctgatttgccgccggaagaagcgcaggagtgtcac
gccgcctgccgcgaatatggtctcgatctgatcttcttcgtcgcacccacgacccctgat
gagcgcattgcccgcattactgcgctcgccagcggtttcatctattgcgtttcgctgacc
ggcgtcaccggcgcgcggcgcgaattgtggagcggactgcccgccttcctggaacgggtg
cggcgtcacaccaccctgccgctcgttgtcgggttcggcatcagcagcgccgatcatgtg
cgtgaggtcggcaggcatgcggcaggtgcgattgtcgccagtgcgctgatcaacgttatc
gaacagtcgcatcctggcgaatatgtcgcgcgcgcggctgagttcgtgcggttgttgcgc
ggctga

DBGET integrated database retrieval system