KEGG   Roseiflexus castenholzii: Rcas_2011Help
Entry
Rcas_2011         CDS       T00585                                 

Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00010  Glycolysis / Gluconeogenesis
rca00020  Citrate cycle (TCA cycle)
rca00620  Pyruvate metabolism
rca01100  Metabolic pathways
rca01110  Biosynthesis of secondary metabolites
rca01120  Microbial metabolism in diverse environments
rca01130  Biosynthesis of antibiotics
rca01200  Carbon metabolism
Module
rca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rcas_2011
   00020 Citrate cycle (TCA cycle)
    Rcas_2011
   00620 Pyruvate metabolism
    Rcas_2011
Enzymes [BR:rca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rcas_2011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H PYNP_C
Motif
Other DBs
NCBI-ProteinID: ABU58099
JGI: Rcas2011
UniProt: A7NKS9
Position
complement(2577544..2578908)
Genome map
AA seq 454 aa AA seqDB search
MPDITMPKMGFDMQEGTIVRWLKKPGDEVRRGEPIAEIETDKVTIEIEAFESGTLTEIVV
PEGQSAPVNAVIARLDGGNGAQPPAPAPIAEAPAPASVAEAPAPATPEPVVAAPAVEVGE
VRASPLARRLAREHGVDLRQVRGSGPAGRIVKEDIEAYLTARGAAPAPAPTPMPKAPAPV
PTPVPTAPAPAPAPAMAAPTPAVQPAPTPAAPVAPPTPALVGAPLAAVVPLSNMRKTIAR
RMLQSWQQFPHIFVSIEVDMGAALALRAQANAGRAKEEQFSVNDMVVKACAGALLAFPNL
NASYSDEGIIRHPMVNIAIAVALESGLMAPVVTNCQDRSLGSIARETKRVVVLAREGKIT
PDLLQGGTFTVSNLGMYGITEFTSIITPPQAASLAVGTIRRVPAFKDDSDEVVAKHLMML
TLSADHRVTDGAEAAQFLNEVKRLLEQPLALLVG
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacattaccatgcccaagatgggcttcgacatgcaggagggcacgatcgttcgc
tggctgaagaagccaggtgacgaggttcgccgcggtgagccaattgccgaaatcgagacg
gataaggtgactattgagatcgaggcgtttgagtccggcactctcaccgagattgtcgtg
ccggaaggacagtcggcgccggtcaatgcggtcattgctcgacttgacggcggcaacgga
gcgcaaccgcccgcccccgcaccgatcgccgaagcgcctgcacccgcgtccgtcgctgaa
gcgcctgcacctgccacacccgagccggttgtcgcggcgcccgccgtggaagtgggagag
gtccgcgcatcaccgctggcgcgtcgtctggcgcgcgaacatggggtcgatctgcgccag
gtgcgcggtagtggcccggcagggcgcatcgtgaaggaagacatcgaagcgtacctgact
gcgcgcggcgcggcgccggcgcctgctccgacacccatgccaaaggcgccggcgccggtc
cccacacctgtaccaacggcgcccgcccctgcacctgcgccggcaatggctgcgccgacg
ccagcagtgcagcccgcgccgacgccagcagcgcccgttgcgccgccaacgcctgcactg
gtcggcgcgccgctggccgccgtcgtaccgctgagcaatatgcgcaagaccattgcgcgc
cgcatgctgcaaagctggcagcagtttccgcacatctttgtgtctatcgaagtcgatatg
ggtgcagcgcttgcattgcgcgcgcaggcgaacgccggacgggcaaaagaggaacagttc
tcggtcaacgatatggtggtcaaagcgtgcgctggcgcgctgctcgcctttcccaatctc
aacgcctcctatagcgacgaagggatcatccggcatccgatggtcaatatcgccattgcg
gtcgcattggagagcgggctgatggcgccggttgtgaccaattgccaggaccgctcactc
ggttcgattgcgcgcgagaccaaacgggtcgttgtgctggcgcgcgaggggaagatcacc
cccgatctgcttcagggaggcacgtttacggtcagtaatctggggatgtacggcatcact
gaattcacatcgatcatcacgccgccgcaagccgccagcctggcggtcggcacaatccgg
cgcgtcccggcgttcaaagacgacagcgacgaggtggtggcaaaacatctgatgatgctg
accctctcggcggaccaccgcgtcaccgacggcgctgaggcggctcagtttctcaacgag
gtgaaacgcctgttggagcaaccactggcactgctggtagggtga

DBGET integrated database retrieval system