KEGG   Roseiflexus castenholzii: Rcas_2031Help
Entry
Rcas_2031         CDS       T00585                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00860  Porphyrin and chlorophyll metabolism
rca01100  Metabolic pathways
rca01110  Biosynthesis of secondary metabolites
rca01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rcas_2031
Enzymes [BR:rca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Rcas_2031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Oxidored_nitro Amidase
Motif
Other DBs
NCBI-ProteinID: ABU58119
JGI: Rcas2031
UniProt: A7NKU9
Position
2603472..2604281
Genome map
AA seq 269 aa AA seqDB search
MDTTGQLQGKRIAVTRAAERAEGLAAALSSEGAEVLVCPTIAYAPPDDPDRLEAALERLD
QYDWIIFTSVAAVDTLARYQALPPPLHVRVAAVGKATAAAIESRGGRVDLLPAQQNAEGL
LAELRNVAGQRFLLPVSDIARDTLAVGLREREALVDVVTAYRTVPGPGVRDLIDPLCRRA
IDAVVFSSPSTLRYLIDGMEQFGIARSVARALFDGVALIAIGPTTAQALRDEGLSVAAQA
PNPAVEGVAEAVCAGLNDVGARLRRAHGQ
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggacacgaccggtcaattgcaagggaaacggatcgcagtcacacgcgctgccgaacgg
gcagaaggtttggcggcagcgctgagcagtgaaggggctgaggtgctggtttgcccgaca
atcgcctatgccccgccggatgatcctgatcggctcgaagcagcactcgagcgtctcgac
cagtacgactggatcattttcaccagtgtcgcagccgtcgatacactcgctcggtatcag
gcgctgccgccgccgttgcacgtgcgggtggcggcagtcgggaaagcgacggctgccgct
atcgagtcgcgcggcgggcgggtcgatctgctgccagcgcaacaaaacgcggaagggttg
ctggcagaactgcgaaacgtcgccggtcaacgctttctgctgccggtctccgacatcgca
cgcgatacgctagcagtcggtttgcgcgagcgtgaagcgttggtcgatgtggtgaccgcc
taccggacggttcccggtccgggggtgcgtgatctgatcgatccgctctgccgccgcgcc
attgatgccgtcgtgttcagcagcccatcgacattgcgctacctgatcgacggcatggaa
cagttcggcatcgcccgttccgtggcacgcgccctgttcgacggcgttgcgttgattgcg
ataggaccgacgaccgcgcaggcgctgcgggacgaaggtctgtccgttgccgcacaggcg
ccgaatccggcggtggaaggagtggcggaagcggtgtgtgcggggttaaatgacgtaggg
gcacgcctgaggcgcgcccatgggcagtag

DBGET integrated database retrieval system