KEGG   Roseiflexus castenholzii: Rcas_2032Help
Entry
Rcas_2032         CDS       T00585                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rca  Roseiflexus castenholzii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rcas_2032
Enzymes [BR:rca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Rcas_2032
Exosome [BR:rca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rcas_2032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2604866..2605849
Genome map
AA seq 327 aa AA seqDB search
MLINRPRRLRRTPALRRMVCETVLSADDLIAPLFVVAGSGVVRPIRSMPGHAQISVDQLD
PEISEIAELQIPAVLLFGIPAHKDPTGSSGWDPEGPVPQAIRAIKRLAPQLTVIADVCVC
EYTSHGHCGILAETPGSGDVLNDPTLEILARCAVAYADAGADIVAPSAMMDGQVAAIRAA
LDAAGYTQVAILSYAAKFASAFYGPFREAAESTPAFGDRRAYQMDPANGREALREVELDI
AEGADMIMVKPAGAYLDIISTVRQRYHVPLAAYQVSGEYAMIKAAAQLGWLDERRAALES
LIAIRRAGADMIITYFAKDAARWIAAE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcttatcaatcgtccacgacgattacgccgcactcccgcactgcggcgcatggtgtgc
gaaaccgtgttgagcgccgacgatctgatcgcgccactcttcgttgtcgccggcagcggc
gttgtgcgtccgatccgctcgatgccggggcatgcccagatatcggtcgatcaacttgac
cctgaaatcagcgaaatcgccgaactccagataccggctgtcctcctgtttggcattcca
gcgcacaaagacccgaccggcagcagtggttgggacccggagggtccggtgccacaggcg
attcgcgccatcaagcggcttgctcctcaattgaccgttatcgcagatgtgtgcgtctgt
gagtacaccagccatggacattgcggtattctggcggagacgcctggcagtggcgatgtg
ctcaacgatccgacgctcgaaattctggcgcgttgtgccgtggcgtatgccgatgccggc
gccgacatcgttgctcccagcgccatgatggatggtcaggtcgctgcgattcgcgccgct
ctcgacgccgcaggttatacgcaggtcgctatcctgtcgtatgccgccaagtttgcgtcc
gccttctacggaccattccgtgaagccgccgagtctacgccagcgttcggcgaccggcgc
gcctatcagatggacccggcgaacggacgtgaggcgttgcgtgaggtggaactcgatatt
gccgaaggcgccgatatgatcatggtcaaaccggcaggcgcgtatctcgacattatcagc
acggtgcggcagcgctatcatgtgccgctggcagcgtatcaggtgagcggcgagtatgcc
atgatcaaagcggcggcgcaactcggttggctcgacgagcgccgcgccgccctcgaaagt
ctgatcgccattcgccgcgccggagcggatatgatcatcacctacttcgccaaggatgcc
gcgcgctggattgctgcggagtga

DBGET integrated database retrieval system