KEGG   Roseiflexus castenholzii DSM13941: Rcas_2411Help
Entry
Rcas_2411         CDS       T00585                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rca  Roseiflexus castenholzii DSM13941
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rca00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rca00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:rca00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:rca00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:rca00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3104025..3104942)
Genome map
AA seq 305 aa AA seqDB search
MGDETIKVAILGSGNIGTDLMYKLLDCPASMELVLLAGIDPNSEGLARARALGVAASAQG
IDAVLEHPDIQIVFDATSAKAHVRHAKLLRETGRTAIDLTPAARGPYVVPPVNLRQHLDA
PNVNLITCGGQATIPLVYAVSRVTPVRYAEIVSTVASRSAGPGTRQNIDEFTFTTAHGLE
VIGGAQQGKAIIILNPAEPPILMRNTVYALPEDDFDPAQVRDSIEAMVAEVQQYVPGYRL
KNPPVFDMRDTPWGRKSAVTVLLEVEGAGHFLPTYAGNLDIMTASARRVGDVFARHLLSR
REVAV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatgaaacgataaaagtggccatcctcggctccgggaatatcggaaccgacctc
atgtataaactccttgattgccccgcttcgatggaattggtgttactggcggggatcgat
ccaaactctgaaggtctggcgcgcgcgcgcgcgctgggtgttgcggcgagcgcacaaggc
attgatgcggtgctggaacatcccgacattcagatcgtcttcgatgcaactagcgcaaaa
gcgcatgtgcgccacgcaaaactcttgcgcgagaccggcaggaccgctattgatctgacc
ccagcggctcgtggaccctacgttgtgccgccggtcaatctccggcaacacctcgatgca
ccaaatgtcaacctgatcacctgcggcggtcaggcgacgattccactggtttatgccgtc
agccgcgtgacgccagtgcgctacgccgaaattgtcagcacggtcgccagccgctctgct
ggaccgggcacgcgccagaatatcgacgagttcaccttcaccacggcgcacggtctggaa
gtcattggcggtgcgcaacagggcaaggcgatcattattctcaacccggcggaaccgccg
atcctgatgcgtaatacggtctatgctctcccagaggatgatttcgacccggcacaggtg
cgcgactccatcgaggcgatggtggctgaggtgcagcagtacgtacccggctatagacta
aagaatccaccggtcttcgacatgcgcgacacaccgtggggacgtaagtcggcggtgacg
gtgctgctcgaagttgagggcgcggggcacttcctcccaacctacgccggcaacctggac
atcatgaccgcttcggcgcggcgggttggtgacgtctttgcccgacatctgttgagccgt
cgggaggtggcggtatga

DBGET integrated database retrieval system