KEGG   Roseiflexus castenholzii: Rcas_2411Help
Entry
Rcas_2411         CDS       T00585                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rca  Roseiflexus castenholzii
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Rcas_2411
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rcas_2411
   00650 Butanoate metabolism
    Rcas_2411
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Rcas_2411
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rcas_2411
   00622 Xylene degradation
    Rcas_2411
   00621 Dioxin degradation
    Rcas_2411
Enzymes [BR:rca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Rcas_2411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3104025..3104942)
Genome map
AA seq 305 aa AA seqDB search
MGDETIKVAILGSGNIGTDLMYKLLDCPASMELVLLAGIDPNSEGLARARALGVAASAQG
IDAVLEHPDIQIVFDATSAKAHVRHAKLLRETGRTAIDLTPAARGPYVVPPVNLRQHLDA
PNVNLITCGGQATIPLVYAVSRVTPVRYAEIVSTVASRSAGPGTRQNIDEFTFTTAHGLE
VIGGAQQGKAIIILNPAEPPILMRNTVYALPEDDFDPAQVRDSIEAMVAEVQQYVPGYRL
KNPPVFDMRDTPWGRKSAVTVLLEVEGAGHFLPTYAGNLDIMTASARRVGDVFARHLLSR
REVAV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatgaaacgataaaagtggccatcctcggctccgggaatatcggaaccgacctc
atgtataaactccttgattgccccgcttcgatggaattggtgttactggcggggatcgat
ccaaactctgaaggtctggcgcgcgcgcgcgcgctgggtgttgcggcgagcgcacaaggc
attgatgcggtgctggaacatcccgacattcagatcgtcttcgatgcaactagcgcaaaa
gcgcatgtgcgccacgcaaaactcttgcgcgagaccggcaggaccgctattgatctgacc
ccagcggctcgtggaccctacgttgtgccgccggtcaatctccggcaacacctcgatgca
ccaaatgtcaacctgatcacctgcggcggtcaggcgacgattccactggtttatgccgtc
agccgcgtgacgccagtgcgctacgccgaaattgtcagcacggtcgccagccgctctgct
ggaccgggcacgcgccagaatatcgacgagttcaccttcaccacggcgcacggtctggaa
gtcattggcggtgcgcaacagggcaaggcgatcattattctcaacccggcggaaccgccg
atcctgatgcgtaatacggtctatgctctcccagaggatgatttcgacccggcacaggtg
cgcgactccatcgaggcgatggtggctgaggtgcagcagtacgtacccggctatagacta
aagaatccaccggtcttcgacatgcgcgacacaccgtggggacgtaagtcggcggtgacg
gtgctgctcgaagttgagggcgcggggcacttcctcccaacctacgccggcaacctggac
atcatgaccgcttcggcgcggcgggttggtgacgtctttgcccgacatctgttgagccgt
cgggaggtggcggtatga

DBGET integrated database retrieval system