KEGG   Roseiflexus castenholzii DSM13941: Rcas_2434Help
Entry
Rcas_2434         CDS       T00585                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rca  Roseiflexus castenholzii DSM13941
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rca00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rca00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3127561..3128517
Genome map
AA seq 318 aa AA seqDB search
MSVPAAAGAARHRRRHVLDLDDFSAQEIDEILETAVSMKEVLGRAIKQVPTLRGKTIVNM
FFEESTRTRISFELAGKALSANVVNFTARGSSVEKGESLIDTVRTLQALGADMLVMRHSE
SGAPYLVAQHFHGSVINAGDGRHAHPTQALLDLFTVRQRLGRIEGLKVVIVGDILHSRVA
RSDLWGFTRMGALVTLCAPQTLIGPEAFWKATWPDLTITSNLDECVRDADVIMTLRLQKE
RMEAGLLPSLREYTRFFAITAERVARAAPHCLVMHPGPMNEGVEIMPDVAVSAQSVIEEQ
VANGVAVRMALLYRLSGE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtacctgcggcagcaggagccgccagacatcgtcgacgccacgtgcttgatctc
gatgatttctctgcgcaagaaatcgatgaaatcctcgaaactgccgtcagcatgaaagag
gtgctcgggcgtgccatcaagcaggtgccgacgctgcgcgggaaaaccattgtcaacatg
ttcttcgaggaaagcacccgcacgcgcatctcgtttgaacttgccggaaaagcgctttcc
gcgaatgtcgtgaattttaccgcgcgtggcagcagcgtggagaaaggcgagtcgctgatc
gatacggtgcgcacgcttcaggcgctcggcgctgatatgctggtcatgcgccatagtgaa
tcgggcgcgccctatctcgtcgcacaacacttccacgggtcggtcattaatgccggtgac
ggacggcacgcgcatccgactcaggcgctgctcgatctgtttaccgtgcggcagcgtctg
ggacgcatcgaggggttgaaggtcgtgattgtcggcgatattctgcacagccgcgtcgcc
cggtccgatctctgggggtttacccggatgggagcattggtgacgctctgcgccccacag
acgttgatcggtcccgaggcgttctggaaagcgacctggcccgatctgacgatcaccagc
aaccttgatgagtgtgtccgagacgctgatgtgatcatgacgctgaggttgcagaaggaa
cggatggaagcaggattgctcccttcgctgcgggaatacacccgcttttttgcgatcact
gccgagcgcgtggcgcgcgccgcgccgcactgtctggtaatgcatcccggaccgatgaac
gaaggcgtcgagattatgcccgatgtggccgtatcggcgcaatcggtcatcgaagagcag
gtcgccaacggcgtggcggtgcggatggcattgctgtatcgtctctccggcgagtaa

DBGET integrated database retrieval system