KEGG   Roseiflexus castenholzii: Rcas_2493Help
Entry
Rcas_2493         CDS       T00585                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
rca  Roseiflexus castenholzii
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rcas_2493
  Lipid metabolism
   00600 Sphingolipid metabolism
    Rcas_2493
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Rcas_2493
Enzymes [BR:rca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Rcas_2493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3210643..3213774)
Genome map
AA seq 1043 aa AA seqDB search
MHPTDDSPLPMLFIAGMKTWEMPELTALNTLPPHALTVPFPADADMSVDPSASPWYQSLS
GVWEFRLLPRPDAVTAAALAAGDWCPIQVPGNWTMQGFGTPHYTNVQMPFPHLPPFVPDD
NPTGVYRRQFTLPPQWHRRRIVLHIAGCEGACYVYLNGAPIGLHKDSRTPAEYDVTGAVR
FDAPNELIAVVLRWSDASFVEDQDHWWQSGIHRDVFLYATDTVYLADLSARGDVSDDLRE
GTLQVRCTLDAIAEAEEHTRVEVQLYDASGAPVFAEPLRATYTQTHPRFGVRRFVRPELC
LEGQVESPHLWSAETPYLYMLVVTLHRPAGPERHTCYVGFRSIAIRNRQLLVNGRVITIK
GVNRHDHSDTTGKAVSRALMELDIQRMKQFNINAVRTSHYPNDPYWLDLCDRYGLYVIDE
ANIESHAFYFDICRDARYTRAFVERVRNMIERDKNHPSVIFWSLGNESGYGPNHDAAAGL
ARRLDPSRPLHYEGAISRWMGESWQDGRTVTDVICPMYAPIDEIVAWAEQETDDPRPLIL
CEYSHAMGNSNGSLADYWEAFERHPTLQGGFIWEWLDHGIRVADDQGRVYWAYGGDFGDV
PNDANFVCDGLVWPDRSPHPALYEYKYLIQPVRGELVDPAGVTVRIVNRQDFADLDWLYG
VWEVTVDGLPVASGELPELYAAPGEAQVVSLDLGAASSAPGERFLTLRFYQRNATLWAPS
GHEVSWQQLPLPTIAVAPEPEVTSASVAVEEIAGQIVLRAGAVRAAFDTTTGLLTSFGSG
SENLIVRGPLLNVWRAATDNDGLKVWNEPDKPLARWKALGLHQVQHRLRRIRLMAASDEA
ATVEIEHGASGRGEWRDFTHIHRYTLDASGELLVENTVLIGSAISDIPRVGVRLTLIPGL
EHLEWHGRGPWDNYSDRKASAIVGRWRSTVTDQYVPYIMPQEHGHKTDVRSLRLTDADGR
GLFVAGRPTFEFSALHHSDDDLFRALHTIDLTPRAEVFLNLDAAHRGLGTLSCGPDTLER
YRLMESEYQFVYRMRILGEPVDE
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgcaccctaccgacgactcgccgctccctatgcttttcatcgcgggcatgaaaacctgg
gagatgcccgaattgacggcgctcaatacgttgccaccacacgcactgaccgttccattt
ccagcagatgccgacatgtccgtcgatccatcggcatcgccatggtatcagagtctgagc
ggtgtgtgggagttccgcctgctgccgcgccctgatgccgtgaccgccgctgcattggca
gcaggcgactggtgtccgatccaggtccccggcaattggacgatgcagggcttcgggacg
ccgcactataccaatgtgcagatgcccttcccgcatttgccgccgttcgtgccagacgat
aatcccaccggcgtttaccgccgtcagtttacgcttcctccacaatggcacagacgccgg
atcgtcctccacatcgccgggtgtgagggcgcgtgctatgtgtacctcaatggcgcacca
atcgggctgcataaggactcgcgcacgcccgccgagtatgatgtgaccggcgccgtgcgc
ttcgatgcgccgaatgagttgatcgccgtcgtgttgcgctggtccgacgccagtttcgtg
gaagatcaggaccactggtggcagtcgggcattcaccgtgacgtgtttctctatgcgacc
gataccgtctacctggcggatctgtcggcgcgcggggatgtgagcgatgatctacgggaa
ggaacgctccaggtgcgttgcacactcgacgccatcgccgaagccgaagagcatacccgc
gtcgaggtgcaactctatgacgcaagcggcgcaccggtcttcgcagagccgctgcgcgca
acgtatacgcaaacccatccgcgctttggcgtgcgtcgcttcgtgcgcccggaactgtgc
ctggaaggacaggttgagtcgccgcatctatggtcagcagaaacgccgtatctgtacatg
ctcgtggttacgctccatagaccggcgggaccggaacgtcacacctgctatgtcgggttt
cgctcgattgccattcgcaatcggcagttgctggtgaacggcagagtaatcacgatcaaa
ggtgtcaatcgccacgaccattccgacacaactggcaaggcggtcagccgcgccttgatg
gaactcgatattcagcgcatgaagcagttcaacatcaacgccgtgcgcacgtcgcattac
ccaaatgacccatactggctcgatctgtgcgatcgctacgggttgtacgtcatcgacgag
gcgaatatcgagtcgcacgccttctatttcgacatctgccgcgatgcacgctacactcgc
gcattcgtcgagcgcgtgcgcaacatgatcgagcgcgacaagaatcatccctcggttatc
ttctggtcattagggaacgaaagcgggtatggtcccaaccacgatgctgccgccggtctg
gcgcgtcgcctcgatccgtcacgaccgctgcactatgagggcgccatctcgcggtggatg
ggagagtcgtggcaggatgggcgcacagtcaccgatgtgatctgcccgatgtatgcgcca
attgatgagattgtcgcctgggcggaacaagagaccgatgatccgcgtcccctgatcctg
tgcgaatactcgcacgccatggggaacagcaacggtagtctggcagattactgggaagcg
ttcgagcgccacccgacgttgcagggcgggttcatctgggaatggctcgaccatggcatc
cgtgtcgccgacgatcaggggcgtgtctattgggcgtatggcggcgatttcggtgatgtt
cccaacgatgccaacttcgtttgcgacggtctggtgtggcccgaccgttcacctcacccg
gcattgtacgaatacaaatatctgatccagccggtgcggggtgaactggtcgatccggcg
ggcgtaacggtgcgaatcgtcaaccggcaagattttgccgatctcgactggctgtatggc
gtgtgggaagtgacggtcgatggtctgccggtggcgtcgggcgagttgccggaactgtac
gctgcgccgggtgaggcgcaggtggtgagtcttgacctcggcgcagcgagcagcgctccc
ggagagcggttcctgacgctgcgcttctatcagcgcaatgcgacactctgggcgccatcc
gggcacgaggtgtcctggcaacaactgccgctgccgacgattgccgttgcgcctgaaccg
gaagtgacatcggcatcggttgctgtcgaagagatcgccgggcagatcgtcttgcgcgcc
ggcgccgtgcgcgctgctttcgatacgacgaccggtcttttgacttcattcggcagcgga
tcagagaacctgattgttcgcggaccgctgctcaatgtctggcgcgccgccacagacaac
gacgggctaaaggtgtggaatgagccggacaaaccgctggcgcgctggaaagcactggga
ttgcaccaggtgcaacatcgcctgcgcaggatacgcctgatggctgccagcgatgaagcg
gcaaccgtcgaaatcgagcatggcgcctctggccgtggggagtggcgcgatttcacccat
atccatcgctacacactggacgccagcggtgagctgctggtcgagaacaccgtcctcatc
ggtagtgcgatcagcgacatcccgcgcgtcggagtacgcctgacgctgattccggggctt
gaacatctcgaatggcacggacgcggaccgtgggataactatagtgaccgcaaagcaagc
gccattgtggggcgttggcgctcgaccgtgaccgaccagtacgtgccctatattatgccg
caggaacacgggcataaaaccgatgtgcgctccctgcgcctgaccgacgctgatgggcgc
ggattgtttgtcgccgggcgtccgaccttcgagttttcggcgctccaccacagcgacgac
gacctgttccgcgctctgcacacgatcgatctgactccgcgcgccgaagtattcctcaac
ctcgatgccgcgcatcgcgggcttggaacgttgagttgcggacccgacacgctcgaacgc
taccgcctgatggagagtgaataccaattcgtgtaccggatgcgtattctgggagagccg
gttgatgaatga

DBGET integrated database retrieval system