KEGG   Roseiflexus castenholzii: Rcas_2513Help
Entry
Rcas_2513         CDS       T00585                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rca  Roseiflexus castenholzii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rcas_2513
   01230 Biosynthesis of amino acids
    Rcas_2513
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rcas_2513
   00030 Pentose phosphate pathway
    Rcas_2513
   00051 Fructose and mannose metabolism
    Rcas_2513
   00052 Galactose metabolism
    Rcas_2513
  Energy metabolism
   00680 Methane metabolism
    Rcas_2513
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Rcas_2513
Enzymes [BR:rca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rcas_2513
Protein phosphatases and associated proteins [BR:rca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Rcas_2513
Messenger RNA biogenesis [BR:rca03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Rcas_2513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3242225..3243382
Genome map
AA seq 385 aa AA seqDB search
MRIGILTGGGDVPGLNPCIKAVVNRANDAGIEVIGIRRGWAGLLYYNPDDPESASEWVQP
LTKADVRTIDRYGGTHLHTSRTNPQKVREKDMPEFLKGRFEFSGEKKTADCTPHVLRVLE
HLGIDTLVPIGGDDTLSYAVRMHREGVRVIAIPKTMDNDVFGTDYCIGFSTAVTRSVDFL
NALRTPTGSHERIAVIELFGRNSGETALISAYLADVDRAVISEVPFDVEKLARFLVEDRK
RNPSNYSICVISEGASMIGGQVVEYGQEDAYGHRKLGGIGMITGEAIKKITGIDIVYQQL
SYLMRAGAPDSLDRMVAICYGNLAVDQLLQGHSGRMVALQNGQYTTVPVDTCVQGVKRVD
VEELYDTENYRPRVKHPLGKPMFLY
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcggaattctgactggcggtggtgatgttcccggtttgaacccctgtatcaag
gccgtggtgaatcgcgccaacgacgccgggatcgaggtgatcggcattcgacgcggctgg
gccgggttgctctactacaatccggacgatccggagagtgcatcggagtgggtacagccc
cttacaaaagcggacgttcgcacgattgaccgctacggtggaacgcacctgcacacatca
cgcacgaacccgcagaaggtgcgggagaaggatatgcccgaatttctcaaaggcaggttc
gaattctccggcgaaaagaagaccgctgactgcacgccgcacgtgttgcgcgtgctcgaa
cacctcggcatcgatacgcttgtgccgattggcggcgacgacaccctctcttacgcagtg
cgcatgcatcgcgagggggtgcgggtgatcgccatccctaagacgatggataacgacgtg
tttggcaccgattactgcatcggtttctcaacggcggtcacgcgcagtgtcgattttctc
aacgccctccgcacaccgaccggctcgcacgagcgtatcgcagtgatcgagttgtttggg
cgcaactcgggtgaaacggcgctcatttcggcgtatctcgcggatgttgatcgcgctgtt
atctccgaagtgccgttcgatgtcgaaaaactggcgcgcttcctggtcgaagaccgcaaa
cgaaatccgagcaactattccatctgtgtcatctcagaaggcgcatcaatgatcggcggt
caggtggtcgagtatgggcaggaagacgcttatgggcaccggaaactcggcggcatcggc
atgatcaccggcgaggcgatcaaaaagatcaccggcatcgacatcgtttatcagcaacta
tcgtatctgatgcgcgccggcgctcccgactcgctcgaccggatggtggctatctgctac
gggaaccttgcagtcgatcagttgctccaggggcacagtggtcgtatggtggcgctccag
aacggtcagtacaccaccgttccggtcgatacctgtgtgcagggggtcaagcgggtcgat
gtcgaagaactgtatgatacggaaaactatcggccgcgggtcaaacacccgctcggcaag
ccgatgttcctgtactga

DBGET integrated database retrieval system