KEGG   Roseiflexus castenholzii: Rcas_2513Help
Entry
Rcas_2513         CDS       T00585                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00010  Glycolysis / Gluconeogenesis
rca00030  Pentose phosphate pathway
rca00051  Fructose and mannose metabolism
rca00052  Galactose metabolism
rca00680  Methane metabolism
rca01100  Metabolic pathways
rca01110  Biosynthesis of secondary metabolites
rca01120  Microbial metabolism in diverse environments
rca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rcas_2513
   00030 Pentose phosphate pathway
    Rcas_2513
   00051 Fructose and mannose metabolism
    Rcas_2513
   00052 Galactose metabolism
    Rcas_2513
  Energy metabolism
   00680 Methane metabolism
    Rcas_2513
Enzymes [BR:rca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rcas_2513
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Rcas_2513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABU58593
JGI: Rcas2513
UniProt: A7NM38
Position
3242225..3243382
Genome map
AA seq 385 aa AA seqDB search
MRIGILTGGGDVPGLNPCIKAVVNRANDAGIEVIGIRRGWAGLLYYNPDDPESASEWVQP
LTKADVRTIDRYGGTHLHTSRTNPQKVREKDMPEFLKGRFEFSGEKKTADCTPHVLRVLE
HLGIDTLVPIGGDDTLSYAVRMHREGVRVIAIPKTMDNDVFGTDYCIGFSTAVTRSVDFL
NALRTPTGSHERIAVIELFGRNSGETALISAYLADVDRAVISEVPFDVEKLARFLVEDRK
RNPSNYSICVISEGASMIGGQVVEYGQEDAYGHRKLGGIGMITGEAIKKITGIDIVYQQL
SYLMRAGAPDSLDRMVAICYGNLAVDQLLQGHSGRMVALQNGQYTTVPVDTCVQGVKRVD
VEELYDTENYRPRVKHPLGKPMFLY
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcggaattctgactggcggtggtgatgttcccggtttgaacccctgtatcaag
gccgtggtgaatcgcgccaacgacgccgggatcgaggtgatcggcattcgacgcggctgg
gccgggttgctctactacaatccggacgatccggagagtgcatcggagtgggtacagccc
cttacaaaagcggacgttcgcacgattgaccgctacggtggaacgcacctgcacacatca
cgcacgaacccgcagaaggtgcgggagaaggatatgcccgaatttctcaaaggcaggttc
gaattctccggcgaaaagaagaccgctgactgcacgccgcacgtgttgcgcgtgctcgaa
cacctcggcatcgatacgcttgtgccgattggcggcgacgacaccctctcttacgcagtg
cgcatgcatcgcgagggggtgcgggtgatcgccatccctaagacgatggataacgacgtg
tttggcaccgattactgcatcggtttctcaacggcggtcacgcgcagtgtcgattttctc
aacgccctccgcacaccgaccggctcgcacgagcgtatcgcagtgatcgagttgtttggg
cgcaactcgggtgaaacggcgctcatttcggcgtatctcgcggatgttgatcgcgctgtt
atctccgaagtgccgttcgatgtcgaaaaactggcgcgcttcctggtcgaagaccgcaaa
cgaaatccgagcaactattccatctgtgtcatctcagaaggcgcatcaatgatcggcggt
caggtggtcgagtatgggcaggaagacgcttatgggcaccggaaactcggcggcatcggc
atgatcaccggcgaggcgatcaaaaagatcaccggcatcgacatcgtttatcagcaacta
tcgtatctgatgcgcgccggcgctcccgactcgctcgaccggatggtggctatctgctac
gggaaccttgcagtcgatcagttgctccaggggcacagtggtcgtatggtggcgctccag
aacggtcagtacaccaccgttccggtcgatacctgtgtgcagggggtcaagcgggtcgat
gtcgaagaactgtatgatacggaaaactatcggccgcgggtcaaacacccgctcggcaag
ccgatgttcctgtactga

DBGET integrated database retrieval system