KEGG   Roseiflexus castenholzii DSM13941: Rcas_2590Help
Entry
Rcas_2590         CDS       T00585                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
rca  Roseiflexus castenholzii DSM13941
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rca00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3342527..3344935)
Genome map
AA seq 802 aa AA seqDB search
MTQTTVRYAPGWPGIPARWTSSAKTGIGTALNPASRVWFTISHGILNEIYYPRIDQACTR
DCGLIVTDGHSFFSEEKRHTTSIVTMLAVGVPAYRLVNRCQQHRYQIEKMVITHPMYNAV
LQQITFTPLQGSLDQYSVFVLLAPHIGNRGAENTAWIGDYKGLPMLFAERYGLALAVACS
APWTARSVGFVGSSDGWQDLVRNYRLTTLYERAENGNVALTGGIDVMACHGQFTIAIGFG
QTWAEAAWHARAGLSDEFDSVCATYIQAWQTWQQTLTALTTIHQQVSAMVLRVHESKQFP
GGSIASLSIPWGMAKGDDDLGGYHLVWPRDLVEIGGGLLAIGANDDAWRILNYLALTQEP
DGHWPQNMWLDGIPYWNGIQMDETAFPILLLDLAVTTGAIDPATVYRYWPMVRRAASFLV
RNGPVTAQDRWEENAGYSPFTLAVEIAALLVTAELAEQYGEPTIADYLRTTADSWNADID
RWCYVTGTDLAHRVGVTGYYVRIAPPDVAEAASPMQGYVPIKNRPPDQANAPLSYIVSPD
ALALVRFGLRDPHDPRIVNTVQVIDALLKIDTPCGPVWRRYTDDGYGEHQDGAPFDGTGI
GRGWPLLTGERAHYELAAERVEAAKRLLITLEAFANEGGFLPEQVWDSTDIPERELFFGR
PAGSAMPLAWAHAEHLKLCRSLADQRLFDMPRVTAQRYLSRQVQSKIAIWRPNQKRRRIV
AGMTLRIDLNAAAMIHWSADHWQTIHDTTTAASGLGTFFADLPTETLAPATEIVFTLYWI
DQQRWEGRDYTVQIEASGISGE
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaacaacggtacgctatgcacccggttggcccggtattccggcacgctggact
tcgagcgccaaaaccgggatcggaactgcgttaaacccggccagccgggtctggtttacg
attagccacggtattctcaacgagatctactatccgcggattgatcaagcttgcacccgc
gattgtggcttgattgtcaccgatggtcattcgtttttctctgaagagaaacgtcatacc
accagcatcgttacgatgctggccgtaggtgtgccggcttaccgattggtgaacagatgc
caacaacatcgctatcagatcgagaaaatggttatcacccatccaatgtacaacgcggtg
ttgcagcagattacctttactccactgcaaggttcgcttgatcagtattcggtgtttgta
ttactggctccgcatatcggtaatcgtggtgctgagaatacggcatggatcggtgactac
aaaggattgccgatgctctttgccgagcggtatggtcttgccttggctgtagcttgctcg
gccccgtggacagcacgctcggtcgggtttgtcggcagctctgatggctggcaagatttg
gtccgtaactatcgactgacaactctttacgaacgggcagaaaacggcaatgtggccctg
accggcgggatcgatgtgatggcatgtcacgggcagtttactatcgcgattggcttcggt
caaacatgggctgaagcggcgtggcatgcccgtgccggtctgagcgacgaattcgactcc
gtctgcgctacgtacatccaggcttggcaaacgtggcaacaaacgctcactgctctgacc
accattcatcaacaggtgagcgcgatggtgttacgggtacatgaatcgaagcaatttccc
ggtggaagtatcgccagcctctctattccatggggtatggccaaaggtgatgatgacctc
ggtggttatcatctggtgtggccgcgcgatctggtcgaaattggtggtggactactggca
atcggagccaatgatgatgcatggcgtattctcaattatcttgcccttacccaagaaccc
gatggacactggccgcaaaatatgtggctcgacggtataccgtactggaacggtattcaa
atggacgaaacggcatttcctatcttactcctcgacctggcagtaacgactggcgcgatt
gatccggctaccgtttaccgctattggccaatggttcgacgcgcggcgagtttccttgtt
cgcaatggaccggtcaccgcccaagatcgctgggaggagaacgccggctactcacccttt
acactagcagtggaaattgctgccctgctcgtgaccgccgaactggccgaacagtatggt
gaaccgactatcgctgactatctccgcaccacagccgatagctggaatgccgatattgac
cgctggtgctacgtgaccggaaccgatcttgcccatcgtgtcggagtaacggggtattat
gtacggattgcaccacccgatgtcgccgaagcggcttcaccaatgcaaggctacgtgccg
attaagaatcgtccacccgaccaagccaacgcaccgctgagctatatcgtcagtcctgat
gctttagcccttgtgcgtttcggcttgcgcgacccacacgatccacggattgtaaataca
gtacaggtcatcgacgcactattgaagatcgatacaccgtgtggaccggtgtggcgacgg
tacaccgacgatggttacggtgaacatcaagatggtgctccatttgacggcaccggtatc
ggtcgtggatggccgttactgaccggtgaacgcgctcactacgaacttgcagccgagcga
gttgaagcggcgaaacgactgctcataacgttggaagcgttcgcgaacgaaggtggtttc
cttcccgaacaggtgtgggacagtaccgacattcccgaacgagagcttttttttggccgg
ccagcggggtcagccatgccgctcgcgtgggctcatgccgaacaccttaaactttgccgt
tctcttgccgaccaacgtctgtttgacatgccacgagtgaccgcacagcggtatctcagt
cggcaggtgcagagcaagattgccatctggcgtccgaaccaaaaacgacggcgaatagtg
gcagggatgacgttacgtatcgatctgaatgccgctgcgatgatccactggagcgccgat
cactggcagacgattcacgataccacgacggctgctagcggactggggacctttttcgct
gatttaccgaccgaaacgttggcgcctgcgactgagatcgtgtttacgctgtactggatc
gatcaacaacggtgggaagggcgcgattacacagtgcagatcgaagcatccggcataagc
ggagagtag

DBGET integrated database retrieval system