KEGG   Roseiflexus castenholzii: Rcas_2631Help
Entry
Rcas_2631         CDS       T00585                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
rca  Roseiflexus castenholzii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rcas_2631
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rcas_2631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3392752..3393195)
Genome map
AA seq 147 aa AA seqDB search
MNRTYTITFACLLTLTLALSACGGGQGAPAANAPVEPLTRTISANGDPAKGQLYFENEGG
CLACHSTGTDKLVGPGLAGVMTTAGPVYPEGVNYRGNLPNGQPRTEENIAAWIRSGGQGQ
IGVMSPHEMSDEDMANLLAYLHTLKRP
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcacgtatacgataaccttcgcctgcctgctcacattgacgctggcgctgtcc
gcatgcggcggcgggcagggcgctcccgcagcaaatgcgccggtagagccgctgacgcgc
acgatctctgccaatggcgatcccgccaaggggcaactctacttcgagaacgagggtgga
tgcctggcgtgccactcgaccggcaccgataaacttgtgggtccggggctggccggtgtg
atgacaacggcgggtccggtctatcccgaaggggtcaactaccgcggcaatctgcccaac
ggacagccgcgcaccgaagaaaacatcgccgcctggattcgcagcggtggtcaggggcag
atcggcgtaatgtcgccacacgaaatgagcgatgaagatatggccaatctgttagcgtat
ttgcacacgctgaagcgaccgtag

DBGET integrated database retrieval system