KEGG   Roseiflexus castenholzii: Rcas_2763Help
Entry
Rcas_2763         CDS       T00585                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rca  Roseiflexus castenholzii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rcas_2763
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rcas_2763
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rcas_2763
Enzymes [BR:rca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rcas_2763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3575977..3577197
Genome map
AA seq 406 aa AA seqDB search
MIFRMQQATTLDPAYAGRFGPYGGAYIPETLAPAVAALEQAYANARQDPEFWAELDRLHR
SYTGRPTPLTFAQRLTEHLGGAQIYLKREDLAHTGAHKINNALGQGLLAKRMGKTRIIAE
TGAGQHGVATATVCALLGMECVVYMGVDDMARQQPNVFRMRLLGAEVRGVASGSRTLKDA
INEAMRDWVTNPDSYYLLGSALGPHPYPTMVRDFQSVIGREAREQMLALTGRLPDVVLAC
VGGGSNAIGIFHAFLDDAEVALRGVEAGGRGITPGDHAARFAGGRPGVLQGTYTYVLQND
DGQIGLTHSVSAGLDYAAIGPEHALLHDQGRATYTVADDEEALDAFQTLARLEGIIPALE
SAHAVAEAIKLAPTMRPDQIILINLSGRGDKDIFTVAKVLGVDVAH
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgatattccgtatgcaacaggcgacgacacttgatccagcctatgccggacgcttcggt
ccctacggcggggcatacattcccgaaacactggcgccagcggttgcggcgctcgaacag
gcatatgccaacgcccgtcaggatccggagttctgggcggaactcgaccggttgcaccgc
agttataccggcagacccacgccgctgacttttgcgcagcggctgacagagcaccttggc
ggcgcacagatctacctcaagcgcgaggacctggcgcacaccggcgcgcacaagatcaac
aatgcgctcggacagggactgttggcgaagcgcatggggaaaacgcggatcatcgctgaa
accggcgccgggcagcacggcgtcgcaaccgccactgtctgcgcgttgctcggcatggag
tgcgtggtgtacatgggcgtcgatgatatggcgcgccagcaaccgaatgtcttccgtatg
cgattgctcggcgcagaggtgcgtggggttgccagcggatcacggacactcaaagatgcg
atcaacgaagccatgcgcgactgggtgacgaacccggactcgtactatctcctcggctcg
gcgcttggtccgcatccctacccgacgatggtgcgcgactttcagagcgtgatcggacgt
gaggcgcgcgagcagatgctggcattaaccgggcgcttgcccgatgtggtgctggcatgc
gtcggcggcggctcgaatgctattggcatcttccatgcgttcctcgacgatgccgaggtg
gcattgcgtggcgttgaggctggcgggcgcggcatcacgccaggcgaccacgcggcgcgc
tttgcgggggggcgtccgggcgtccttcaaggaacatacacctatgtgctacaaaacgat
gacgggcagatcgggttaacccatagcgtctcggccggtctcgactatgccgcgattgga
ccggaacatgccctgctccacgatcaggggcgcgcaacctacacggttgccgacgatgaa
gaggcgctcgatgcgtttcagacgctggcgcggctcgaaggaatcattccggcgctcgaa
agcgcgcacgcggttgccgaagcgatcaaactcgcgccgaccatgcgccccgatcagatc
atcctgatcaacctttcggggcgcggtgacaaggacatttttaccgtggcgaaggtgttg
ggggtggacgttgcacattga

DBGET integrated database retrieval system