KEGG   Roseiflexus castenholzii: Rcas_2804Help
Entry
Rcas_2804         CDS       T00585                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00020  Citrate cycle (TCA cycle)
rca00310  Lysine degradation
rca01100  Metabolic pathways
rca01110  Biosynthesis of secondary metabolites
rca01120  Microbial metabolism in diverse environments
rca01130  Biosynthesis of antibiotics
rca01200  Carbon metabolism
Module
rca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rcas_2804
  Amino acid metabolism
   00310 Lysine degradation
    Rcas_2804
Enzymes [BR:rca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rcas_2804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ABU58875
JGI: Rcas2804
UniProt: A7NMV1
Position
3625709..3627046
Genome map
AA seq 445 aa AA seqDB search
MAVDIVLPQIGESMTEATIGRWLKRVGDRIERFEALVEVETDKVSTEVTSIASGILLEIV
TPEGATVPVGTLLARIGETAERHVSAAPAPSQETTAAPEPVRIRRGDGPPITPVVARLAA
EYGIDLSQIRGTGAGGRVSKKDVLRYIEMQKAAAALLPGAPTAPPPAPEAPPIPSVSTAP
SPPLARETPSTAPVAEAPPALPTAQRPPITQPLPDEAILTPLTTMRRMIADHMVRSLRDA
PQATTVFEVDMGRVLAHRDRYRASFEQQGIRLTLTAYVVQAVATALRRVPALNTRFTDEG
IITYRRINIGVAVALDDGLIVPVLRDADEKSLAGIARALNDLTERARARRLQPDDTEGGT
FTISNHGVGGSLFATPILNRGQSGILGVGAVVKRAVVVTHQGNDAIVIRPMCYLSLTFDH
RACDGATADAFLAAVKEVLETYPEQ
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgatatcgttcttccacagatcggcgaaagtatgaccgaagccacgatcggg
cgctggctcaagcgtgtcggcgaccgcatcgaacgcttcgaggcattggtggaagtcgag
acggataaagtctcgaccgaagtgacctcgattgccagtggcattttgctcgaaatcgtg
acgcctgaaggcgccacagtgccggttggcacgcttctggcgcgtatcggcgagacggcg
gagaggcatgtgagcgcagcgccagcgccgtcgcaggagacaacggcagcgccagaacct
gtgcgcatccgccgcggcgatggtccgccgatcacgccggtggtggcgcgtctggctgct
gaatatggtatcgacctgagccaaatccgtggcaccggcgccggcgggcgcgtcagcaag
aaggatgtgttgcgctacatcgagatgcagaaagcggctgccgctttgctgcccggcgca
cccactgcgccgcctccggcgcccgaagcgcctcccatcccatctgtttccacagcgcca
tcaccccctctagcgcgcgaaacgccttctactgcgcctgttgccgaagcgccgcctgcc
ctgcccacagcgcagcgccctccaatcacgcaaccgttgcccgacgaggcgatcctcacg
ccattgaccacgatgcgacgcatgatcgccgatcatatggtccgctccctgcgcgacgcc
ccgcaggccacgacggtctttgaggtcgatatggggcgcgtgctggcgcaccgcgaccgg
tatcgcgcctcttttgaacagcaagggatacggttgactctgacagcgtatgtggttcag
gcggttgcgactgcgctgcgccgcgttccggcattgaacacgcgcttcactgacgaaggg
atcatcacataccggcggatcaacattggggtggcggtcgccctcgacgacggattgatc
gtgccggtgctgcgtgacgccgacgagaaaagtctggccggcatcgcgcgcgcgttgaac
gacctgacggagcgcgcccgcgcgcgccgcctgcaaccggacgacaccgaagggggaacg
tttaccatctcgaaccatggcgttggcggcagtctgttcgccacgccgatcctcaaccgt
ggacagagcggtattcttggcgtcggcgccgtggtgaagcgcgcggtcgttgtgacccat
caggggaatgatgcgattgtcattcgcccgatgtgctacctgtcgttgacattcgaccac
cgcgcctgtgatggcgcgaccgccgacgcatttctggcagcggtcaaagaggttctggaa
acctaccccgagcaataa

DBGET integrated database retrieval system