KEGG   Roseiflexus castenholzii: Rcas_2804Help
Entry
Rcas_2804         CDS       T00585                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rca  Roseiflexus castenholzii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rcas_2804
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rcas_2804
  Amino acid metabolism
   00310 Lysine degradation
    Rcas_2804
Enzymes [BR:rca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rcas_2804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3625709..3627046
Genome map
AA seq 445 aa AA seqDB search
MAVDIVLPQIGESMTEATIGRWLKRVGDRIERFEALVEVETDKVSTEVTSIASGILLEIV
TPEGATVPVGTLLARIGETAERHVSAAPAPSQETTAAPEPVRIRRGDGPPITPVVARLAA
EYGIDLSQIRGTGAGGRVSKKDVLRYIEMQKAAAALLPGAPTAPPPAPEAPPIPSVSTAP
SPPLARETPSTAPVAEAPPALPTAQRPPITQPLPDEAILTPLTTMRRMIADHMVRSLRDA
PQATTVFEVDMGRVLAHRDRYRASFEQQGIRLTLTAYVVQAVATALRRVPALNTRFTDEG
IITYRRINIGVAVALDDGLIVPVLRDADEKSLAGIARALNDLTERARARRLQPDDTEGGT
FTISNHGVGGSLFATPILNRGQSGILGVGAVVKRAVVVTHQGNDAIVIRPMCYLSLTFDH
RACDGATADAFLAAVKEVLETYPEQ
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgatatcgttcttccacagatcggcgaaagtatgaccgaagccacgatcggg
cgctggctcaagcgtgtcggcgaccgcatcgaacgcttcgaggcattggtggaagtcgag
acggataaagtctcgaccgaagtgacctcgattgccagtggcattttgctcgaaatcgtg
acgcctgaaggcgccacagtgccggttggcacgcttctggcgcgtatcggcgagacggcg
gagaggcatgtgagcgcagcgccagcgccgtcgcaggagacaacggcagcgccagaacct
gtgcgcatccgccgcggcgatggtccgccgatcacgccggtggtggcgcgtctggctgct
gaatatggtatcgacctgagccaaatccgtggcaccggcgccggcgggcgcgtcagcaag
aaggatgtgttgcgctacatcgagatgcagaaagcggctgccgctttgctgcccggcgca
cccactgcgccgcctccggcgcccgaagcgcctcccatcccatctgtttccacagcgcca
tcaccccctctagcgcgcgaaacgccttctactgcgcctgttgccgaagcgccgcctgcc
ctgcccacagcgcagcgccctccaatcacgcaaccgttgcccgacgaggcgatcctcacg
ccattgaccacgatgcgacgcatgatcgccgatcatatggtccgctccctgcgcgacgcc
ccgcaggccacgacggtctttgaggtcgatatggggcgcgtgctggcgcaccgcgaccgg
tatcgcgcctcttttgaacagcaagggatacggttgactctgacagcgtatgtggttcag
gcggttgcgactgcgctgcgccgcgttccggcattgaacacgcgcttcactgacgaaggg
atcatcacataccggcggatcaacattggggtggcggtcgccctcgacgacggattgatc
gtgccggtgctgcgtgacgccgacgagaaaagtctggccggcatcgcgcgcgcgttgaac
gacctgacggagcgcgcccgcgcgcgccgcctgcaaccggacgacaccgaagggggaacg
tttaccatctcgaaccatggcgttggcggcagtctgttcgccacgccgatcctcaaccgt
ggacagagcggtattcttggcgtcggcgccgtggtgaagcgcgcggtcgttgtgacccat
caggggaatgatgcgattgtcattcgcccgatgtgctacctgtcgttgacattcgaccac
cgcgcctgtgatggcgcgaccgccgacgcatttctggcagcggtcaaagaggttctggaa
acctaccccgagcaataa

DBGET integrated database retrieval system