KEGG   Roseiflexus castenholzii: Rcas_2804Help
Entry
Rcas_2804         CDS       T00585                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rca  Roseiflexus castenholzii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rcas_2804
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rcas_2804
  Amino acid metabolism
   00310 Lysine degradation
    Rcas_2804
Enzymes [BR:rca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rcas_2804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3625709..3627046
Genome map
AA seq 445 aa AA seqDB search
MAVDIVLPQIGESMTEATIGRWLKRVGDRIERFEALVEVETDKVSTEVTSIASGILLEIV
TPEGATVPVGTLLARIGETAERHVSAAPAPSQETTAAPEPVRIRRGDGPPITPVVARLAA
EYGIDLSQIRGTGAGGRVSKKDVLRYIEMQKAAAALLPGAPTAPPPAPEAPPIPSVSTAP
SPPLARETPSTAPVAEAPPALPTAQRPPITQPLPDEAILTPLTTMRRMIADHMVRSLRDA
PQATTVFEVDMGRVLAHRDRYRASFEQQGIRLTLTAYVVQAVATALRRVPALNTRFTDEG
IITYRRINIGVAVALDDGLIVPVLRDADEKSLAGIARALNDLTERARARRLQPDDTEGGT
FTISNHGVGGSLFATPILNRGQSGILGVGAVVKRAVVVTHQGNDAIVIRPMCYLSLTFDH
RACDGATADAFLAAVKEVLETYPEQ
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgatatcgttcttccacagatcggcgaaagtatgaccgaagccacgatcggg
cgctggctcaagcgtgtcggcgaccgcatcgaacgcttcgaggcattggtggaagtcgag
acggataaagtctcgaccgaagtgacctcgattgccagtggcattttgctcgaaatcgtg
acgcctgaaggcgccacagtgccggttggcacgcttctggcgcgtatcggcgagacggcg
gagaggcatgtgagcgcagcgccagcgccgtcgcaggagacaacggcagcgccagaacct
gtgcgcatccgccgcggcgatggtccgccgatcacgccggtggtggcgcgtctggctgct
gaatatggtatcgacctgagccaaatccgtggcaccggcgccggcgggcgcgtcagcaag
aaggatgtgttgcgctacatcgagatgcagaaagcggctgccgctttgctgcccggcgca
cccactgcgccgcctccggcgcccgaagcgcctcccatcccatctgtttccacagcgcca
tcaccccctctagcgcgcgaaacgccttctactgcgcctgttgccgaagcgccgcctgcc
ctgcccacagcgcagcgccctccaatcacgcaaccgttgcccgacgaggcgatcctcacg
ccattgaccacgatgcgacgcatgatcgccgatcatatggtccgctccctgcgcgacgcc
ccgcaggccacgacggtctttgaggtcgatatggggcgcgtgctggcgcaccgcgaccgg
tatcgcgcctcttttgaacagcaagggatacggttgactctgacagcgtatgtggttcag
gcggttgcgactgcgctgcgccgcgttccggcattgaacacgcgcttcactgacgaaggg
atcatcacataccggcggatcaacattggggtggcggtcgccctcgacgacggattgatc
gtgccggtgctgcgtgacgccgacgagaaaagtctggccggcatcgcgcgcgcgttgaac
gacctgacggagcgcgcccgcgcgcgccgcctgcaaccggacgacaccgaagggggaacg
tttaccatctcgaaccatggcgttggcggcagtctgttcgccacgccgatcctcaaccgt
ggacagagcggtattcttggcgtcggcgccgtggtgaagcgcgcggtcgttgtgacccat
caggggaatgatgcgattgtcattcgcccgatgtgctacctgtcgttgacattcgaccac
cgcgcctgtgatggcgcgaccgccgacgcatttctggcagcggtcaaagaggttctggaa
acctaccccgagcaataa

DBGET integrated database retrieval system