KEGG   Roseiflexus castenholzii: Rcas_2947Help
Entry
Rcas_2947         CDS       T00585                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rca  Roseiflexus castenholzii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Rcas_2947
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rcas_2947
Enzymes [BR:rca01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Rcas_2947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3823663..3824166)
Genome map
AA seq 167 aa AA seqDB search
MGIYDITANRIDGTPQPLSDYRNRVLLIVNVASKCGFAPQYAGLETLYRRYRDEGFVVLG
FPCDQFAGQEYDDPNAIQQFCTRNYGVSFPIFEKVDVNGPNTHPLFALLKAEKPGLLGIQ
TIPWNFTKFLVDRQGKVRRRYAPTDTPEKIERDIAALLRQPTAITAQ
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgggcatatacgacatcaccgccaaccgcattgacggcacaccgcagccgctcagcgac
taccggaaccgggtgctgctgatcgtcaacgtcgccagcaaatgtggatttgcgccgcag
tatgccggtctcgaaaccctctaccgccgctaccgcgacgaaggttttgttgtgctcgga
ttcccgtgcgaccagttcgccgggcaggaatacgacgatccgaacgccatccagcagttc
tgcacgcgcaactatggggtcagttttccgatctttgagaaggtggatgtcaacggtccg
aacacccatccattgttcgcgctgctgaaagcggaaaagccgggattgttgggcatccag
acgattccgtggaacttcaccaagtttctggtggaccgccaggggaaagtgcgtcgccgt
tacgcccccaccgatacgccggaaaagatcgagcgcgacattgctgcgctgctgcgccag
ccgacggcgattacggctcagtaa

DBGET integrated database retrieval system