KEGG   Roseiflexus castenholzii: Rcas_2967Help
Entry
Rcas_2967         CDS       T00585                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rca  Roseiflexus castenholzii
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rcas_2967
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Rcas_2967
   00680 Methane metabolism
    Rcas_2967
Enzymes [BR:rca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Rcas_2967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3847935..3850667)
Genome map
AA seq 910 aa AA seqDB search
MSIGLGDIPAQARIERDLRWLLDRFYEALDAAGAADIHALLPWTGNPSCPVRLPERAPQA
YAIAFQLLNLVEENAEAQTRRSAETIDGPAALRGLWGQILVQLRDAGLSAAQIAAALPRI
QVELVLTAHPTEAKRATVLAHYRELYLQLVKAENQMWTPLERQGIAEDVRAILERLWRTG
DIFLKRPDVSSELRNVIHYLRNVFPEALAYHDQRLRQIWEAIGNDPALLDDPDSLPLITF
GTWVGGDRDGHPLVTADVTRMALMELRSHALELLRDQLTTLVRRLSLSNLLQTPPDFLTS
ALHHYADLLGDAGQQALDRNPHEPWRQMVNLMLARLPETAGVPAPGHYTRAAELIADLRL
LDESLVAVGATRLARSDVRPLIRSVRVFGFHLAVLDIRQNSAFHDRALAQLLTAAGIDGS
DYPSWDEARRMALIEAELESPRPFTRMGMPVGPEAEAVLSCYRVLVEHIHSYGADGLGAL
IVSMTRNLSDLLVVFLFARETGLLVSTPEGPVCPLPIVPLFETIDDLERSPLVLRDYLAH
PIVQRSLEWQRQTRGAPERVQQVMIGYSDSNKDGGIGASLWALQKAQQALAAEGRMAGVR
IRFFHGRGGTMSRGAGPTGRFIRALPVEALAGDLRMTEQGETISQKYANRISAVYNFELL
LAGVTGSTLRPYTPRPQHLTMALDLLARHSQRAYRALVEHERFLPFFREATPIDAIEASR
IGSRPARRTGAQSLTDLRAIPWVFSWNQARFYLSGWYGIGSGLAMVQAEEPALFDTLCAE
MREWAPLHYLLGNAATSVMNADEHIMRAYAELVHDPVTRTVILDTILEEFARTRAMLERV
YGGSLEEKRPYIARQLELRRAGLYSLHREQITSLRSWRAVRNLDPEAGEAQLRLLLLLIN
AIAAGLRATG
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcggtttgggcgacataccggcgcaggcacgcatcgagcgtgatctgcgctgg
ctgcttgatcggttctacgaggcgcttgatgccgccggcgccgccgatattcatgcgctg
ctgccctggacggggaatccgtcgtgtccggtgcggttgcctgagcgtgcgccacaggca
tatgccattgcgtttcagttgctcaacttggttgaagagaatgctgaagcgcaaacgcgc
cgctctgcggagaccattgatggaccggctgcactgcgtggtctctggggacagatcctg
gttcagttgcgcgatgcagggttgagtgcagcgcagattgccgctgcgttgccgcgcata
caggtcgaactcgtgttgacggcgcatcccaccgaagccaaacgcgcgacagtgctggcg
cactaccgtgagctttacctgcaactggtcaaagccgaaaaccagatgtggacgccgctg
gagcggcagggcattgctgaggatgtgcgcgcgattctggagcggctctggcgaaccggc
gacatctttctcaagcgacccgatgtttcctccgagctgcgcaacgtcattcactacctt
cgcaatgtgttccccgaagcgctggcataccacgatcaacggttacgtcagatatgggag
gcgattggcaatgatccggcgttgctggatgatcccgactcgctgccgttgattaccttt
gggacatgggtcggcggcgaccgggatgggcatccgttggtgaccgccgatgtcacccgc
atggcgttgatggaattgcgctcgcatgcgctcgaactgctgcgtgatcaattaacaacg
ctggtgcggcgtctgagtttgtctaatctgctgcaaaccccgcctgatttcctgacaagc
gcgttgcaccattatgctgatctgttgggagatgcagggcagcaggcgctggatcgcaat
ccgcacgaaccgtggcgccagatggtcaacctgatgctggcgcggttgccggaaaccgct
ggcgtgcccgcgcctggacattacacgcgcgctgccgaactcattgccgacctgcgcctg
cttgacgagtcgcttgtggcagtgggtgcgacgcggttggcccgatccgacgtgcgcccg
ctcattcgcagcgtccgtgtctttggctttcacctcgcggtgctcgatattcgacagaac
agcgcatttcacgatcgggcgctggcgcaacttctcacggcggccggcatcgacgggagc
gattacccctcctgggacgaagcccgccgcatggcgctgatcgaagcggaactggagtcg
ccgcgtccctttactcgaatgggcatgcccgtcggaccagaagccgaggctgtactgagt
tgttatcgggtgctggtcgaacacatccactcctatggcgccgatggattgggtgcgctg
atcgtcagtatgacacgcaacctgtccgatctcctggttgtcttccttttcgcccgtgaa
acgggattgctcgtcagcacgccggaaggtccggtctgtcctttgccgattgtgccactc
ttcgagacgatcgacgatctggaacggagtccgctggttctgcgcgactacctggcgcat
ccgatcgtacagcgcagtctggagtggcaacggcagacgcgaggagcgcccgaacgggtg
cagcaggtgatgattgggtatagcgacagcaacaaggatggcggcatcggcgcaagcctg
tgggcattgcagaaggcgcagcaggcgcttgccgccgaaggacggatggcaggagtgcgc
attcgcttcttccacggtcgcgggggaacaatgagtcgcggcgctggaccgaccggacgc
ttcatcagggcattgccggttgaagcgctggcaggcgacctccgcatgactgaacaggga
gagacaatttctcagaaatacgccaatcgcatcagtgctgtctataacttcgaactcttg
ctggcgggcgtcacggggtccacgctccgaccgtacacgccccgaccacagcatctaacg
atggcgctcgacctgcttgcccggcacagtcagcgagcatatcgcgcgctggtggagcat
gagcgttttcttccgttctttcgggaagcgacgccaattgacgctatcgaggcgagtcgg
atcggctcgcgtccggcgcggcgcaccggcgcgcagtctctcaccgacctgcgcgccatt
ccgtgggtgttcagttggaaccaggcgcgcttttacctgtcgggctggtatggcatcggc
agcgggctggcaatggtgcaggcggaggaaccggcgctgttcgataccctctgtgccgaa
atgcgcgaatgggcgccactgcactatctcctgggaaatgcggcaacgagcgtgatgaat
gcggatgagcacatcatgcgcgcctatgcggagttggtgcatgatcccgtcacccgaacc
gtcattctcgataccattctggaagaatttgcgcgcacccgcgcgatgctcgaaagggtc
tatggcggatctctcgaggaaaaacgtccctatatcgcccgccagctcgaattgcggcga
gcgggattgtattccctccatcgcgaacagatcacgagtctacgctcctggcgagcggtg
cgcaacctcgatccagaagcaggcgaagcgcagctgcgcctgcttctgctgctgatcaat
gcgattgcggctggtttgcgcgccacagggtaa

DBGET integrated database retrieval system