KEGG   Roseiflexus castenholzii: Rcas_3026Help
Entry
Rcas_3026         CDS       T00585                                 

Definition
(RefSeq) hypothetical protein
  KO
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
rca  Roseiflexus castenholzii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rcas_3026
   01230 Biosynthesis of amino acids
    Rcas_3026
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rcas_3026
   00030 Pentose phosphate pathway
    Rcas_3026
   00051 Fructose and mannose metabolism
    Rcas_3026
  Energy metabolism
   00680 Methane metabolism
    Rcas_3026
Enzymes [BR:rca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Rcas_3026
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Rcas_3026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3922695..3923834
Genome map
AA seq 379 aa AA seqDB search
MAAELTISCIKADVGGFVGHSAIHPALKDEAGRQLEIARRHGLLIDFHVTACGDDLGLLM
THRLGVDNHDIHRLAWDVFDICTRVAKELKLYGAGQDLLKDAFSGNVRGMGPGIAEMTIV
ERLSEPIIVFFADKTSAGAWNLPLFRMFADPFNTAGLVISPAMHEGFRFRVLDVRKGETI
TLSTPEEMYDLLVFIGAPGRYVVESITAKSTGVIGAVSSTQRLALIAGRYVGKDDPVCIV
RAQGEFPAVGEVLEPFTMPHIVEGWMRGSHYGPLMPCRIGDAHPGRFDGPPRVIALGFQI
AEGRLIGPRDMFDDPSFDEARRLCNVIADHLRRHGPFEPHRLPMEEMEYTTLPEVMKKLA
DRWQPVNGHAVSPEQVAYQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggaattgacgatcagctgcatcaaggctgatgtgggcggattcgtcgggcac
tcggcaatccatccggcgttgaaggacgaggcaggacgtcaactggaaatcgcgcgccgt
cacggtctcttgatcgattttcacgtcactgcgtgcggggatgacctggggttgctcatg
acccaccgcctgggtgtcgataaccacgatattcaccgtctcgcctgggatgtgttcgat
atctgcacccgcgtggcgaaggaactgaaactgtacggcgccggacaggacctgttgaag
gatgcgttttccggcaatgtgcgcggcatgggtccgggcatcgccgagatgaccatcgtc
gagcgtctatcagagccgatcattgtgttctttgccgataaaaccagcgccggcgcctgg
aacctgccgctcttccgtatgtttgccgatccgttcaacaccgcagggctggtgatttca
ccggcgatgcacgaagggtttcgcttccgtgtgctcgatgtgcgcaagggcgagacgatc
accctgagcacaccggaggagatgtacgatctcctcgtcttcattggtgcaccagggcgc
tacgtggtagaaagcataacggcaaagagcaccggcgtcatcggtgcggtgtcgtctaca
caacggctggcgctgattgccgggcgctacgtcgggaaggacgacccggtctgtattgtg
cgggcgcagggtgagttcccggcggtcggcgaggtgctggagccattcacgatgccgcac
attgtcgaaggatggatgcgtggatcgcactacggtccgctgatgccctgccgcatcggt
gatgcccatccggggcgcttcgacggaccaccgcgggtgattgcgctggggttccagatc
gctgaggggcggctgattggaccgcgtgatatgttcgatgatcccagtttcgatgaggcg
cgtcgtctgtgcaatgtcatcgccgaccatctgcgccgtcatggtcccttcgagccgcac
cgcctgccgatggaggagatggaatataccacgcttccagaggtgatgaagaaactggca
gatcgctggcagccggtgaatggtcacgcggtcagcccggagcaggtggcataccaatga

DBGET integrated database retrieval system